GapMind for catabolism of small carbon sources

 

Protein WP_041378948.1 in Rhizorhabdus wittichii RW1

Annotation: NCBI__GCF_000016765.1:WP_041378948.1

Length: 252 amino acids

Source: GCF_000016765.1 in NCBI

Candidate for 78 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-proline catabolism opuBA med BilEA aka OpuBA protein, component of A proline/glycine betaine uptake system. Also reported to be a bile exclusion system that exports oxgall and other bile compounds, BilEA/EB or OpuBA/BB (required for normal virulence) (characterized) 45% 73% 197.6 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-lysine catabolism hisP med Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale) 41% 91% 167.9 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-glutamate catabolism gltL med GluA aka CGL1950, component of Glutamate porter (characterized) 42% 91% 162.5 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-asparagine catabolism aatP med ABC transporter for L-asparagine and L-glutamate, ATPase component (characterized) 41% 89% 160.2 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-aspartate catabolism aatP med ABC transporter for L-asparagine and L-glutamate, ATPase component (characterized) 41% 89% 160.2 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
putrescine catabolism potA lo spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized) 42% 58% 171.8 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
N-acetyl-D-glucosamine catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 43% 63% 166.4 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
D-glucosamine (chitosamine) catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 43% 63% 166.4 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
xylitol catabolism Dshi_0546 lo ABC transporter for Xylitol, ATPase component (characterized) 37% 75% 164.1 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-asparagine catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 37% 90% 160.6 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-aspartate catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 37% 90% 160.6 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
D-sorbitol (glucitol) catabolism mtlK lo ABC transporter for D-Sorbitol, ATPase component (characterized) 36% 76% 159.1 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
lactose catabolism lacK lo ABC transporter for Lactose, ATPase component (characterized) 39% 68% 157.1 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
sucrose catabolism thuK lo ABC transporter (characterized, see rationale) 38% 63% 157.1 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-histidine catabolism PA5503 lo Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized) 45% 66% 156.4 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
D-maltose catabolism malK lo ABC-type maltose transporter (subunit 3/3) (EC 7.5.2.1) (characterized) 38% 63% 155.6 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-fucose catabolism SM_b21106 lo ABC transporter for L-Fucose, ATPase component (characterized) 41% 57% 154.8 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-asparagine catabolism bgtA lo ATPase (characterized, see rationale) 38% 91% 153.7 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-aspartate catabolism bgtA lo ATPase (characterized, see rationale) 38% 91% 153.7 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-histidine catabolism hutV lo ABC transporter for L-Histidine, ATPase component (characterized) 37% 83% 153.7 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
D-mannitol catabolism mtlK lo SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized) 36% 76% 153.7 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-asparagine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 37% 92% 152.9 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-aspartate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 37% 92% 152.9 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-glutamate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 37% 92% 152.9 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-histidine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 37% 92% 152.9 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-leucine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 37% 92% 152.9 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-proline catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 37% 92% 152.9 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
D-alanine catabolism Pf6N2E2_5405 lo ABC transporter for D-Alanine, ATPase component (characterized) 36% 93% 150.2 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
D-cellobiose catabolism msiK lo MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 35% 64% 150.2 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-proline catabolism proV lo glycine betaine/l-proline transport atp-binding protein prov (characterized) 39% 54% 150.2 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
D-glucosamine (chitosamine) catabolism AO353_21725 lo ABC transporter for D-Glucosamine, putative ATPase component (characterized) 36% 92% 149.8 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
D-cellobiose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 36% 68% 147.9 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
D-glucose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 36% 68% 147.9 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
lactose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 36% 68% 147.9 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
D-maltose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 36% 68% 147.9 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
D-maltose catabolism thuK lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 36% 68% 147.9 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
D-mannose catabolism TT_C0211 lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 36% 68% 147.9 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
sucrose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 36% 68% 147.9 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
trehalose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 36% 68% 147.9 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
trehalose catabolism thuK lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 36% 68% 147.9 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
D-maltose catabolism malK_Bb lo ABC-type maltose transport, ATP binding protein (characterized, see rationale) 37% 63% 146 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-citrulline catabolism PS417_17605 lo ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale) 38% 86% 145.6 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-arginine catabolism artP lo BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) 36% 97% 143.7 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-asparagine catabolism glnQ lo Glutamine ABC transporter ATP-binding protein, component of Glutamine transporter, GlnQP. Takes up glutamine, asparagine and glutamate which compete for each other for binding both substrate and the transmembrane protein constituent of the system (Fulyani et al. 2015). Tandem substrate binding domains (SBDs) differ in substrate specificity and affinity, allowing cells to efficiently accumulate different amino acids via a single ABC transporter. Analysis revealed the roles of individual residues in determining the substrate affinity (characterized) 36% 96% 143.7 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-histidine catabolism bgtA lo BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) 36% 97% 143.7 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-tryptophan catabolism ecfA1 lo Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale) 39% 80% 142.1 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-histidine catabolism BPHYT_RS24015 lo ABC transporter related (characterized, see rationale) 39% 87% 141.7 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
D-maltose catabolism malK1 lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 35% 70% 141.7 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
D-xylose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 37% 61% 140.2 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
D-cellobiose catabolism SMc04256 lo ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 38% 59% 139.8 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
D-maltose catabolism musK lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 36% 64% 139.4 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
trehalose catabolism malK lo MsmK aka SMU.882, component of The raffinose/stachyose transporter, MsmEFGK (MalK (3.A.1.1.27) can probably substitute for MsmK; Webb et al., 2008). This system may also transport melibiose, isomaltotriose and sucrose as well as isomaltosaccharides (characterized) 37% 56% 139.4 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-proline catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 35% 81% 139 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
D-galactose catabolism PfGW456L13_1897 lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 37% 56% 138.7 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
trehalose catabolism treV lo TreV, component of Trehalose porter (characterized) 34% 66% 138.3 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-arabinose catabolism xacK lo Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 36% 59% 137.9 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-asparagine catabolism peb1C lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 34% 95% 137.9 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-aspartate catabolism peb1C lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 34% 95% 137.9 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
D-glucosamine (chitosamine) catabolism SM_b21216 lo ABC transporter for D-Glucosamine, ATPase component (characterized) 33% 70% 137.9 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-tryptophan catabolism ecfA2 lo Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale) 36% 78% 136.3 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
D-maltose catabolism malK_Sm lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 37% 55% 135.6 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-arabinose catabolism xacJ lo Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 35% 58% 131.3 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
glycerol catabolism glpS lo ABC transporter for Glycerol, ATPase component 1 (characterized) 34% 70% 127.5 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-histidine catabolism Ac3H11_2560 lo ABC transporter for L-Histidine, ATPase component (characterized) 39% 76% 124.4 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-alanine catabolism braG lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 31% 95% 115.5 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-isoleucine catabolism livF lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 31% 95% 115.5 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-leucine catabolism livF lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 31% 95% 115.5 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-serine catabolism braG lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 31% 95% 115.5 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-threonine catabolism braG lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 31% 95% 115.5 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-valine catabolism livF lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 31% 95% 115.5 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-arginine catabolism braG lo ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) 32% 93% 115.2 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-glutamate catabolism braG lo ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) 32% 93% 115.2 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-histidine catabolism braG lo ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) 32% 93% 115.2 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-proline catabolism HSERO_RS00895 lo ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale) 34% 91% 114.4 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-phenylalanine catabolism livF lo high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized) 32% 93% 109.8 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-proline catabolism HSERO_RS00900 lo ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale) 31% 92% 96.3 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
D-alanine catabolism AZOBR_RS08250 lo Leucine//isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale) 31% 90% 95.5 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9
L-proline catabolism AZOBR_RS08250 lo Leucine//isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale) 31% 90% 95.5 Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 45% 221.9

Sequence Analysis Tools

View WP_041378948.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MISFDHVGKHYAGRHVLDDVSLTIERGSFVALVGASGAGKTTLLKAINRLVEIDTGTIAI
EGRDVAAQPVAELRRRIGYVFQGIGLFPHMSVAENVALVPRLQGVPREERAARVAELLDL
VALPADFAERRPAQLSGGQAQRVGFARALAARPAIMLMDEPFGALDPVTRDELGAAYRAL
HEAMGLTSLIVTHDMAEALLLADRVIVIGEGRILADQPPRALIHGAGDPRIEAMIAVARR
SAARLDAIAAGR

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory