Align Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale)
to candidate WP_041378948.1 SWIT_RS04010 ABC transporter ATP-binding protein
Query= uniprot:D4GP39 (383 letters) >NCBI__GCF_000016765.1:WP_041378948.1 Length = 252 Score = 134 bits (338), Expect = 2e-36 Identities = 75/198 (37%), Positives = 113/198 (57%), Gaps = 4/198 (2%) Query: 24 VEEISLDIDDGEFLVLVGPSGCGKSTTLRMMAGLETVTEGELRLEDR--VLNGVSAQDRD 81 ++++SL I+ G F+ LVG SG GK+T L+ + L + G + +E R V+ R Sbjct: 17 LDDVSLTIERGSFVALVGASGAGKTTLLKAINRLVEIDTGTIAIEGRDVAAQPVAELRRR 76 Query: 82 IAMVFQSYALYPHKSVRGNMSFGLEESTGLPDDEIRQRVEETTDMLGI-SDLLDRKPGQL 140 I VFQ L+PH SV N++ + G+P +E RV E D++ + +D +R+P QL Sbjct: 77 IGYVFQGIGLFPHMSVAENVAL-VPRLQGVPREERAARVAELLDLVALPADFAERRPAQL 135 Query: 141 SGGQQQRVALGRAIVRDPEVFLMDEPLSNLDAKLRAEMRTELQRLQGELGVTTVYVTHDQ 200 SGGQ QRV RA+ P + LMDEP LD R E+ + L +G+T++ VTHD Sbjct: 136 SGGQAQRVGFARALAARPAIMLMDEPFGALDPVTRDELGAAYRALHEAMGLTSLIVTHDM 195 Query: 201 TEAMTMGDRVAVLDDGEL 218 EA+ + DRV V+ +G + Sbjct: 196 AEALLLADRVIVIGEGRI 213 Lambda K H 0.316 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 219 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 252 Length adjustment: 27 Effective length of query: 356 Effective length of database: 225 Effective search space: 80100 Effective search space used: 80100 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory