Align ABC transporter for L-Arginine and L-Citrulline, permease component 2 (characterized)
to candidate WP_012048834.1 SWIT_RS13325 amino acid ABC transporter permease
Query= reanno::pseudo1_N1B4:Pf1N1B4_3433 (232 letters) >NCBI__GCF_000016765.1:WP_012048834.1 Length = 362 Score = 89.4 bits (220), Expect = 9e-23 Identities = 61/203 (30%), Positives = 103/203 (50%), Gaps = 13/203 (6%) Query: 17 GGLVTTLKLLALSLFFGLLAALPLGLMRVSKQPVVNMSAWLFTYVIRGTPMLVQLFLIYY 76 GGL T+ L SL G + L L R S PV +A V+R P++ LF+ Sbjct: 152 GGLPITMLLTIFSLALGFPFGIVLALARRSDMPVYRWTATALIEVMRAMPLVTLLFVA-- 209 Query: 77 GLAQFEAVRESFLWPWLSSATFC--ACLAFAINTSAYTAEIIAGSLRATPNGEIEAAKAM 134 +V L P +A A +AF +++SAY AE++ G L+ P G+ E+A+A+ Sbjct: 210 ------SVMAPLLLPAGVTADNLTRALVAFVLSSSAYIAEVVRGGLQGVPPGQRESARAL 263 Query: 135 GMSRIKMYKRILLPSALRRALPQYSNEVIMMLQTTSLASIVTLIDITGAARTV--NAQFY 192 G+ R + I+LP A+R+AL ++ V+++++ +SL +V L D+ A R + + Sbjct: 264 GLGRSTVLLSIILPQAIRKALAPLTSTVVVIIKNSSLVLVVGLFDLLSAGRVSLNDPAWP 323 Query: 193 LPF-EAYITAGVFYLCLTFILVR 214 P+ E Y+ + Y + + R Sbjct: 324 TPYAETYLVIALIYFVICYGFAR 346 Lambda K H 0.330 0.140 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 180 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 232 Length of database: 362 Length adjustment: 26 Effective length of query: 206 Effective length of database: 336 Effective search space: 69216 Effective search space used: 69216 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory