Align ABC transporter for L-asparagine and L-glutamate, permease component 1 (characterized)
to candidate WP_012048835.1 SWIT_RS13330 ABC transporter permease subunit
Query= reanno::pseudo1_N1B4:Pf1N1B4_772 (248 letters) >NCBI__GCF_000016765.1:WP_012048835.1 Length = 374 Score = 78.2 bits (191), Expect = 2e-19 Identities = 41/130 (31%), Positives = 72/130 (55%) Query: 108 TSAFLSVVVCLGLFTTARVCEQVRTGIQALPRGQEAAARAMGFKLPQIYWNVLLPQAYRI 167 T F++V+ ++ +A E VR G+ +PRGQ A+RA+G Q V++PQA R+ Sbjct: 240 TPEFVAVLWGSVIYASAFAAEIVRGGLDGVPRGQWEASRALGLSKRQSLRLVIVPQALRM 299 Query: 168 IIPPLTSEFLNVFKNSSVASLIGLMELLAQTKQTAEFSANLFEAFTLATLIYFTLNMSLM 227 I+PP+ S+F+ + KNS++A ++G +L + E + L++FTL ++ Sbjct: 300 IVPPMNSQFITILKNSTLALVVGYPDLNFVANTAINHTGQGLEGVAILMLVFFTLASAIS 359 Query: 228 LLMRSVEKKV 237 L M + +V Sbjct: 360 LAMNRLNARV 369 Score = 43.1 bits (100), Expect = 8e-09 Identities = 20/64 (31%), Positives = 39/64 (60%) Query: 25 YLSGLGWTIAIAVAAWIIALLLGSILGVMRTVPNRIVSGIATCYVELFRNVPLLVQLFIW 84 ++ GLG +IA+ + +++ + G + + R + + +A +V+L RNVPL+VQL W Sbjct: 75 FVVGLGNSIALTLLIIVLSTMAGVPIALARHSGHMLARTLAGGFVDLVRNVPLVVQLLFW 134 Query: 85 YFLV 88 Y ++ Sbjct: 135 YGVI 138 Lambda K H 0.326 0.140 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 200 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 248 Length of database: 374 Length adjustment: 27 Effective length of query: 221 Effective length of database: 347 Effective search space: 76687 Effective search space used: 76687 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory