Align ABC-type permease for basic amino acids and glutamine (characterized, see rationale)
to candidate WP_012048834.1 SWIT_RS13325 amino acid ABC transporter permease
Query= uniprot:Q31RP0 (377 letters) >NCBI__GCF_000016765.1:WP_012048834.1 Length = 362 Score = 90.1 bits (222), Expect = 9e-23 Identities = 66/184 (35%), Positives = 95/184 (51%), Gaps = 9/184 (4%) Query: 180 LVVILAIALVL---FVSWLAQRQRSPRDWRWLYGA-IAVVTVLMLLTQLSWPQQLQPGQI 235 L+ I ++AL V LA+R P +RW A I V+ + L+T L + P + Sbjct: 159 LLTIFSLALGFPFGIVLALARRSDMPV-YRWTATALIEVMRAMPLVTLLFVASVMAPLLL 217 Query: 236 RGGLRLSLEFTALLLGLVAYTGAFITEIIRGGILSVPAGQWEAAAALGLTRSQTLWQIVV 295 G+ T L+ V + A+I E++RGG+ VP GQ E+A ALGL RS L I++ Sbjct: 218 PAGVTAD-NLTRALVAFVLSSSAYIAEVVRGGLQGVPPGQRESARALGLGRSTVLLSIIL 276 Query: 296 PQALRVIVPSLNSQYVGFAKNSSLAIAVGYPDLYATAQTTLNQTGRP---VEVFLILMLT 352 PQA+R + L S V KNSSL + VG DL + + +LN P E +L++ L Sbjct: 277 PQAIRKALAPLTSTVVVIIKNSSLVLVVGLFDLLSAGRVSLNDPAWPTPYAETYLVIALI 336 Query: 353 YLAI 356 Y I Sbjct: 337 YFVI 340 Lambda K H 0.326 0.140 0.445 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 317 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 3 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 362 Length adjustment: 30 Effective length of query: 347 Effective length of database: 332 Effective search space: 115204 Effective search space used: 115204 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory