Align glucose 1-dehydrogenase (PQQ, quinone) (EC 1.1.5.2) (characterized)
to candidate WP_011952282.1 SWIT_RS07285 PQQ-dependent sugar dehydrogenase
Query= BRENDA::I7A144 (352 letters) >NCBI__GCF_000016765.1:WP_011952282.1 Length = 530 Score = 184 bits (466), Expect = 6e-51 Identities = 136/373 (36%), Positives = 177/373 (47%), Gaps = 74/373 (19%) Query: 22 RVEEVVGG--LEVPWALAFLPDGGMLIAERPGRIRLFREGRL--STYAELP--VYHRGES 75 R E VVG L+ PW++ FL ML++ERPGR+R+ G A +P V+ G+ Sbjct: 152 RFETVVGEGRLDTPWSILFLSPDRMLVSERPGRLRIVTTGGEVGPPIANVPAIVHDFGQG 211 Query: 76 GLLGLALHPRFPEAPYVYAYRTVAE----GGLRN--------------QVVRLRHLGERG 117 G+LGLA HP + Y+Y T G R +V+R R G Sbjct: 212 GILGLARHPDYRRNGYLYLAYTDEMPDRFGEARKCAGRIYCFSTASQLKVIRFRLAGN-A 270 Query: 118 VLDRVVLDGIPARPHGLHS--GGRIAFGPDGMLYVTTGE-VYERELAQDLASLGGKILRL 174 ++DR + + L GGR+AFG DGMLY+T G+ Y AQD+A+ GKI R+ Sbjct: 271 MVDRTTIWQAAPESYRLSPSFGGRLAFGSDGMLYITVGDRAYSAMEAQDIATPNGKIHRV 330 Query: 175 TPEGEPAPGNPFLGRRGARPEVYSLGHRNPQGLAWHPKTGELFSSEHGPSGEQGYGHDEV 234 +G P NPF+G GA P ++S GHRNPQGLA P++G L+SSEHGP G DE+ Sbjct: 331 ADDGHVPPDNPFVGVPGADPTIWSFGHRNPQGLAVDPRSGRLWSSEHGPRGG-----DEL 385 Query: 235 NLIVPGGNYGWPRVV-GRGNDPRYRDPLY----------------------------FWP 265 NLI GGNYGWP G G D R DP Y W Sbjct: 386 NLIRRGGNYGWPLATFGMGYDGRPFDPAYPLGHSQAAIELTAPSRPIDRAGFIAPVVHWT 445 Query: 266 QGFPPGNLAFFRG--------DLYVAGLRGQALLRLVLEGERGRWRVLRVETALSGFGRL 317 ++ F+ G L V LR Q LLRL +E + V E G + Sbjct: 446 PSIAVSSILFYSGTAFPAWRDSLLVTSLRQQKLLRLTIEHDA----VTEQELLFERHGNV 501 Query: 318 REVQVGPDGALYV 330 R+V PDG+LYV Sbjct: 502 RDVAEAPDGSLYV 514 Lambda K H 0.322 0.146 0.460 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 669 Number of extensions: 51 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 3 Number of HSP's successfully gapped: 1 Length of query: 352 Length of database: 530 Length adjustment: 32 Effective length of query: 320 Effective length of database: 498 Effective search space: 159360 Effective search space used: 159360 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory