Align iron(III) dicitrate transport ATP-binding protein FecE (characterized)
to candidate WP_011951108.1 SWIT_RS01285 ABC transporter ATP-binding protein
Query= CharProtDB::CH_088321 (255 letters) >NCBI__GCF_000016765.1:WP_011951108.1 Length = 266 Score = 159 bits (401), Expect = 7e-44 Identities = 87/239 (36%), Positives = 131/239 (54%) Query: 1 MTLRTENLTVSYGTDKVLNDVSLSLPTGKITALIGPNGCGKSTLLNCFSRLLMPQSGTVF 60 +TL E L + G +L+ + + +G + +IGPNG GKSTL + LL SG V Sbjct: 2 VTLSIEALRIDLGGRAILHGIDAEMRSGSLVGVIGPNGAGKSTLARAVTGLLRSASGRVA 61 Query: 61 LGDNPINMLSSRQLARRLSLLPQHHLTPEGITVQELVSYGRNPWLSLWGRLSAEDNARVN 120 + + S L RR++ LPQ +T + LV+ GR P L+ + ++ D V Sbjct: 62 IDGTNVRAFSPADLGRRIAYLPQGQTVHWPLTAERLVALGRLPHLAPFSAMARADRDAVE 121 Query: 121 VAMNQTRINHLAVRRLTELSGGQRQRAFLAMVLAQNTPVVLLDEPTTYLDINHQVDLMRL 180 AM + I L R +TELSGG+R R +A LA PV+++DEP LD HQ++LM L Sbjct: 122 RAMARADIGGLRDRVVTELSGGERARVLIARALAAEAPVLVVDEPLAALDPGHQLELMDL 181 Query: 181 MGELRTQGKTVVAVLHDLNQASRYCDQLVVMANGHVMAQGTPEEVMTPGLLRTVFSVEA 239 M G V+ +LHDL A+R+CD+L+++ G ++A G P V+TP L +++ A Sbjct: 182 MRAEAEAGTLVLLILHDLAMAARFCDRLLLLHEGRLVADGAPGAVLTPEYLSDCYNIRA 240 Lambda K H 0.320 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 151 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 266 Length adjustment: 24 Effective length of query: 231 Effective length of database: 242 Effective search space: 55902 Effective search space used: 55902 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory