Align ABC transporter for D-Glucosamine, putative ATPase component (characterized)
to candidate WP_011950868.1 SWIT_RS00070 ATP-binding cassette domain-containing protein
Query= reanno::pseudo6_N2E2:Pf6N2E2_2050 (263 letters) >NCBI__GCF_000016765.1:WP_011950868.1 Length = 252 Score = 139 bits (351), Expect = 4e-38 Identities = 90/234 (38%), Positives = 132/234 (56%), Gaps = 11/234 (4%) Query: 16 IRGLRKQYGPLEVLKGVDLSMQRGNVVTLIGSSGSGKTTLLRCVNMLEEFQGGQIMLDGE 75 + G+RK +G VL GVDL+++RG + +IG SGSGK+ +L+C+ L G I +DGE Sbjct: 9 LEGVRKAFGGNAVLDGVDLAIERGESLVIIGQSGSGKSVMLKCILGLIRPDRGAIRVDGE 68 Query: 76 SIGYDDIDGKRVRHPEKVIARHRAMTGMAFQQFNLFPHLTALQNVTLGLLKVKKLPKDEA 135 D+ R E RA GM FQ LF L +NVT L + + + Sbjct: 69 -----DLMAMSARELETA----RAKFGMLFQGSALFDSLPIWRNVTFALTQGRMRDAAKM 119 Query: 136 VALAEKWLERVGL-LERRDHFPGQLSGGQQQRVAIARAIAMNPSLMLFDEVTSALDPELV 194 +A + LERVGL + D P +LSGG Q+RVA+ARAIA P ++ FDE T+ LDP Sbjct: 120 RKIAAENLERVGLGSQVLDLRPSELSGGMQKRVALARAIAPRPEIIFFDEPTTGLDPIRA 179 Query: 195 GEVLNVIKGLAED-GMTMLLVTHEMRFAFEVSDKIVFMNQGRIEEQGPPKELFE 247 + ++I L E+ G+T L +TH+M A +++ ++ + QGRI GP L++ Sbjct: 180 DVINDLIVELVEELGVTALTITHDMASARKIAHRVAMLYQGRIVWSGPRDRLYD 233 Lambda K H 0.320 0.138 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 161 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 252 Length adjustment: 24 Effective length of query: 239 Effective length of database: 228 Effective search space: 54492 Effective search space used: 54492 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory