Align N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized)
to candidate WP_011951122.1 SWIT_RS01355 AAA-associated domain-containing protein
Query= reanno::Phaeo:GFF2754 (331 letters) >NCBI__GCF_000016765.1:WP_011951122.1 Length = 435 Score = 125 bits (313), Expect = 3e-33 Identities = 75/199 (37%), Positives = 114/199 (57%), Gaps = 7/199 (3%) Query: 11 KSFGPVEVLKDINLTVEDGEFVVFVGPSGCGKSTLLRVISGLEDATAGEISIGGQTVTTT 70 + G VL +++LT+++ E V +G SG GKSTLLR I+GL + GE+ V + Sbjct: 23 RGHGRALVLDNVDLTLDENEIVGLLGRSGSGKSTLLRSIAGLIAPSEGEVRF----VPSE 78 Query: 71 PPAKRGIAMVFQSYALYPHLSVRENMALALKQERQPKEEIAARVAEASRMLSLEDYLDRR 130 + ++MVFQ++AL+P L+V +N+ L L+ R P E R A ++ L+ + + Sbjct: 79 DGSPPSVSMVFQTFALFPWLTVLQNVELGLEARRVPAAERRTRALAAIDLIGLDGFENAY 138 Query: 131 PSELSGGQRQRVAIGRAVVREPKLFLFDEPLSNLDAALRMNTRLEIARL---HRQLSASM 187 P ELSGG RQRV + RA+V +P L L DEP S LD R ++ L R S+ Sbjct: 139 PKELSGGMRQRVGLARALVVDPSLLLMDEPFSALDVLTAETLRTDLLDLWSEGRMPIRSI 198 Query: 188 IYVTHDQIEAMTLADKIVV 206 + VTH+ EA+ + D+I+V Sbjct: 199 LIVTHNIEEAVLMCDRILV 217 Lambda K H 0.320 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 318 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 435 Length adjustment: 30 Effective length of query: 301 Effective length of database: 405 Effective search space: 121905 Effective search space used: 121905 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory