Align GluC aka CGL1952, component of Glutamate porter (characterized)
to candidate WP_012048834.1 SWIT_RS13325 amino acid ABC transporter permease
Query= TCDB::P48244 (228 letters) >NCBI__GCF_000016765.1:WP_012048834.1 Length = 362 Score = 92.0 bits (227), Expect = 1e-23 Identities = 61/193 (31%), Positives = 98/193 (50%), Gaps = 15/193 (7%) Query: 18 VTIKLTIYSAIGAMIFGTILTTMRVSPVKILRTLSTAYINTVRNTPLTLVVLFCSFGLYQ 77 +T+ LTI+S FG +L R S + + R +TA I +R PL ++ S Sbjct: 156 ITMLLTIFSLALGFPFGIVLALARRSDMPVYRWTATALIEVMRAMPLVTLLFVAS----- 210 Query: 78 NLGLTLAGRESSTFLVDNNFRLAVLGFILYTSTFVAESLRSGINTVHFGQAEAARSLGLG 137 +A + +N A++ F+L +S ++AE +R G+ V GQ E+AR+LGLG Sbjct: 211 ----VMAPLLLPAGVTADNLTRALVAFVLSSSAYIAEVVRGGLQGVPPGQRESARALGLG 266 Query: 138 FGATFRSIIFPQAVRAAIVPLGNTLIALTKNTTIASVIGV------GEASLLMKATIENH 191 SII PQA+R A+ PL +T++ + KN+++ V+G+ G SL A + Sbjct: 267 RSTVLLSIILPQAIRKALAPLTSTVVVIIKNSSLVLVVGLFDLLSAGRVSLNDPAWPTPY 326 Query: 192 ANMLFVVFAIFAV 204 A V+ I+ V Sbjct: 327 AETYLVIALIYFV 339 Lambda K H 0.327 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 221 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 228 Length of database: 362 Length adjustment: 26 Effective length of query: 202 Effective length of database: 336 Effective search space: 67872 Effective search space used: 67872 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory