Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate WP_041378948.1 SWIT_RS04010 ABC transporter ATP-binding protein
Query= reanno::pseudo5_N2C3_1:AO356_09610 (276 letters) >NCBI__GCF_000016765.1:WP_041378948.1 Length = 252 Score = 150 bits (380), Expect = 2e-41 Identities = 84/230 (36%), Positives = 135/230 (58%), Gaps = 7/230 (3%) Query: 48 VNDLSLSIGTGEIFVIMGLSGSGKSTLVRHFNRLIDPTSGAILVDGEDILQLDMDALREF 107 ++D+SL+I G ++G SG+GK+TL++ NRL++ +G I ++G D+ + LR Sbjct: 17 LDDVSLTIERGSFVALVGASGAGKTTLLKAINRLVEIDTGTIAIEGRDVAAQPVAELRR- 75 Query: 108 RRHKISMVFQSFGLLPHKSVLDNVAYGLKVRGESKQVCAERALHWINTVGLKG-YENKYP 166 +I VFQ GL PH SV +NVA +++G ++ A R ++ V L + + P Sbjct: 76 ---RIGYVFQGIGLFPHMSVAENVALVPRLQGVPREERAARVAELLDLVALPADFAERRP 132 Query: 167 HQLSGGMRQRVGLARALAADTDIILMDEAFSALDPLIRAEMQDQLLELQKTLHKTIVFIT 226 QLSGG QRVG ARALAA I+LMDE F ALDP+ R E+ L + + T + +T Sbjct: 133 AQLSGGQAQRVGFARALAARPAIMLMDEPFGALDPVTRDELGAAYRALHEAMGLTSLIVT 192 Query: 227 HDLDEAVRIGNRIAILKDGKLIQVGTPREILHSPADEYVDRF--VQRRAA 274 HD+ EA+ + +R+ ++ +G+++ PR ++H D ++ V RR+A Sbjct: 193 HDMAEALLLADRVIVIGEGRILADQPPRALIHGAGDPRIEAMIAVARRSA 242 Lambda K H 0.321 0.138 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 153 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 252 Length adjustment: 25 Effective length of query: 251 Effective length of database: 227 Effective search space: 56977 Effective search space used: 56977 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory