Align GDP-6-deoxy-D-talose 4-dehydrogenase (EC 1.1.1.135); 3-hydroxy-2-methylbutyryl-CoA dehydrogenase (EC 1.1.1.178) (characterized)
to candidate WP_011952443.1 SWIT_RS08100 SDR family NAD(P)-dependent oxidoreductase
Query= BRENDA::Q99714 (261 letters) >NCBI__GCF_000016765.1:WP_011952443.1 Length = 260 Score = 237 bits (605), Expect = 2e-67 Identities = 134/255 (52%), Positives = 166/255 (65%), Gaps = 6/255 (2%) Query: 11 LVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKD 70 + A++TGGASGLGLAT L +G + D+ + GEA A + G +F DVT E Sbjct: 7 VAAIVTGGASGLGLATTRALRARGVQVAIFDVNQAVGEAAAAEEG--ALFCNVDVTDEAS 64 Query: 71 VQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQ---TH-TLEDFQRVLDVNLMGTF 126 + + ALA+ G+ + VNCAGI VA KT + TH LE F R L +NL+GTF Sbjct: 65 LDSGFALARAAHGQERILVNCAGIGVAGKTARRDRQTGEITHFPLEAFARALQINLLGTF 124 Query: 127 NVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDL 186 I A M +P G+RG I+NTASVAA +GQ+GQAAYSASK G++GMTLPIARDL Sbjct: 125 GSIAKSAAGMMALDPLPDGERGAIVNTASVAAEDGQMGQAAYSASKAGVIGMTLPIARDL 184 Query: 187 APIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFL 246 A GIRV TI PG F TP+L S P+ V + LA+ VPFP RLG+P+EYA L +I N +L Sbjct: 185 ASEGIRVNTILPGTFSTPMLYSAPQNVRDGLAAAVPFPKRLGEPSEYASLAIEMITNGYL 244 Query: 247 NGEVIRLDGAIRMQP 261 NGE IRLDGAIRM P Sbjct: 245 NGEDIRLDGAIRMAP 259 Lambda K H 0.318 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 213 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 260 Length adjustment: 25 Effective length of query: 236 Effective length of database: 235 Effective search space: 55460 Effective search space used: 55460 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory