Align LacK, component of Lactose porter (characterized)
to candidate WP_012048722.1 SWIT_RS12715 ABC transporter ATP-binding protein
Query= TCDB::Q01937 (363 letters) >NCBI__GCF_000016765.1:WP_012048722.1 Length = 261 Score = 122 bits (305), Expect = 1e-32 Identities = 76/207 (36%), Positives = 112/207 (54%), Gaps = 16/207 (7%) Query: 4 VRLTDIRKSYGSLEVIKGVNLEVSSGEFVVFVGPSGCGKSTLLRMIAGLEDISSGELTIG 63 VRL +++G VI G++L+++ GEFV +G SG GK+TLLR +A L+ ++TI Sbjct: 16 VRLRGFSRAFGETVVIDGLDLDIAPGEFVALLGHSGSGKTTLLRTLANLDQADGQDVTI- 74 Query: 64 GTVMNDVDPSKRGIAMVFQTYALYPHMTVRENMGFALRFAGMAKDEIERRVNAAAKILEL 123 PS R A+VFQ L P V +N+ G+ R AA + L Sbjct: 75 --------PSAR--AVVFQDSRLLPWKRVWKNV-----VLGLPGRRARERAEAALAEVGL 119 Query: 124 DALMDRKPKALSGGQRQRVAIGRAIVRQPDVFLFDEPLSNLDAELRVHMRVEIARLHKEL 183 +D P LSGG+ QR A+ RA+VR+P + L DEP + LDA R+ M + L + Sbjct: 120 SHRVDAWPLTLSGGEAQRTALARALVREPQLLLLDEPFAALDALTRLRMHELVLNLWRAH 179 Query: 184 NATIVYVTHDQVEAMTLADKIVVMRGG 210 ++ VTHD EA+ LAD+++V+ G Sbjct: 180 RPAVLLVTHDVDEAIALADRVLVLAKG 206 Lambda K H 0.320 0.137 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 210 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 261 Length adjustment: 27 Effective length of query: 336 Effective length of database: 234 Effective search space: 78624 Effective search space used: 78624 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory