Align 2-keto-isovalerate dehydrogenase component α subunit (EC 1.2.4.4) (characterized)
to candidate WP_011951901.1 SWIT_RS05380 thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha
Query= metacyc::MONOMER-11683 (330 letters) >NCBI__GCF_000016765.1:WP_011951901.1 Length = 331 Score = 168 bits (425), Expect = 2e-46 Identities = 113/305 (37%), Positives = 162/305 (53%), Gaps = 8/305 (2%) Query: 13 DQEAVDMYRTMLLARKIDERMWLLNRSGKIPFVI-SCQGQEAAQVGAAFALDREMDYVLP 71 + +++ YR M R+ ++ ++ G+IP + + GQEA+ VGA ALD + DY++ Sbjct: 6 NDRSLEKYRRMQRIRQFEDLAEAIHAQGEIPGSLHTYAGQEASGVGACMALD-DTDYMVG 64 Query: 72 YYRDMGVVLAFGMTAKDLMMSGFAKAADPNSG-GRQMPGHFGQKKNRIVTGSSPVTTQVP 130 +R G +A G + LM KA G G M H + +S V + VP Sbjct: 65 THRSHGHPIAKGAKLRPLMAELLGKATGICKGKGGSM--HLSDFSVGSLGETSIVGSGVP 122 Query: 131 HAVGIALAGRMEKKDIAAFVTFGEGSSNQGDFHEGANFAAVHKLPVIFMCENNKYAISVP 190 A G AL +++ A FG+G++N+G FHEG N AAV LP IF+CENN YA+S P Sbjct: 123 VAAGAALGSKLQGNGRVALCFFGDGATNEGAFHEGMNLAAVWALPAIFVCENNGYAVSTP 182 Query: 191 YDKQVACENISDRAIGYGMPGVTVNGNDPLEVYQAVKEARERARRGEGPTLIETISYRLT 250 V +++++RA YGMP + V+G D V AV EA RAR G GPTL+ET +YR Sbjct: 183 ASATVPVKDVAERARAYGMPSIIVDGQDVDAVEAAVAEAVGRARTGGGPTLVETKTYRYA 242 Query: 251 PHSSDDDDSSYRGREEVEEAKKSDPLLTYQAYLKETG---LLSDEIEQTMLDEIMAIVNE 307 H+ + EV+E +K DPL Y+A L G L D IE+ + DE+ + Sbjct: 243 DHAVNMGRVLLDRGGEVDEWRKRDPLALYRAKLIAGGTAAALLDAIEREVADEVADALQF 302 Query: 308 ATDEA 312 A D A Sbjct: 303 ARDSA 307 Lambda K H 0.316 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 252 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 331 Length adjustment: 28 Effective length of query: 302 Effective length of database: 303 Effective search space: 91506 Effective search space used: 91506 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory