Align Isovaleryl-CoA dehydrogenase (EC 1.3.8.4) (characterized)
to candidate WP_011952604.1 SWIT_RS08910 acyl-CoA dehydrogenase family protein
Query= reanno::psRCH2:GFF1051 (387 letters) >NCBI__GCF_000016765.1:WP_011952604.1 Length = 380 Score = 254 bits (648), Expect = 4e-72 Identities = 138/378 (36%), Positives = 215/378 (56%), Gaps = 2/378 (0%) Query: 5 SLNFALGETIDMLREQVQAFVAAEIAPRAEAIDQENLFPADMWRKFGEMGLLGVTVSEEY 64 S FA E + R+ V+ + E+ P + ++E + W GE G+L VS +Y Sbjct: 5 SARFAFDEDHALFRDSVRKMLERELLPNLDRFEEEGIVSRQFWLACGEAGMLCPNVSPDY 64 Query: 65 GGAGLGYLAHVVAMEEISRGSASVALSYGAHSNLCVNQINRNGNPEQKARYLPKLISGEH 124 GG GL + + V EE++ +S + +++ + G+ EQK RYLPK++SGE Sbjct: 65 GGLGLDFGYNAVIDEELAYAGSSAGVPL--QNDITAEYVQSYGSEEQKRRYLPKMVSGEC 122 Query: 125 VGALAMSEPNAGSDVVSMKLRAEKRGDRYVLNGSKTWITNGPDANTYVIYAKTDLDKGAH 184 + A+AM+EP GSD+ +++ A + GDRYV+NG+KT++TNG +A+ ++ AKTD GA Sbjct: 123 ISAIAMTEPATGSDLQAIRTTARRVGDRYVINGAKTYVTNGQNADVVIVAAKTDPGLGAR 182 Query: 185 GITAFIVERDWKGFSRGNKFDKLGMRGSNTCELFFDDVEVPQENVLGAENGGVKVLMSGL 244 G++ +V+ D GF+RG DK+G+ ++T ELFF+DVEVP N LG E G LMS L Sbjct: 183 GLSLILVDADTPGFARGRNLDKIGLWSADTSELFFNDVEVPVANRLGEEGRGFAYLMSQL 242 Query: 245 DYERVVLAGGPTGIMQSCLDVVVPYIHDRKQFGQSIGEFQFIQGKVADMYTQLNASRAYL 304 ER+ +A Q D + ++ DR FGQ I EFQ + +ADM +QL A+L Sbjct: 243 PQERLSIATSAQAAAQRAFDEALAFVKDRTAFGQPIFEFQNTKFTLADMKSQLQVGWAHL 302 Query: 305 YAVAQACDRGETTRKDAAGVILYTAENATQMALQAIQILGGNGYINEFPTGRLLRDAKLY 364 + G T +A+ + ++ ++ A+Q+ GG GY+NE+ RL RDA++ Sbjct: 303 DWAIRRHIAGALTTAEASAAKQWHSDMQGRITDMALQLHGGAGYMNEYLIARLWRDARVT 362 Query: 365 EIGAGTSEIRRMLIGREL 382 I GT+EI + ++ R L Sbjct: 363 RIFGGTNEIMKEVVSRSL 380 Lambda K H 0.318 0.135 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 366 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 380 Length adjustment: 30 Effective length of query: 357 Effective length of database: 350 Effective search space: 124950 Effective search space used: 124950 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory