Align HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized)
to candidate WP_012048833.1 SWIT_RS13320 amino acid ABC transporter ATP-binding protein
Query= TCDB::Q9KKE1 (275 letters) >NCBI__GCF_000016765.1:WP_012048833.1 Length = 241 Score = 135 bits (340), Expect = 8e-37 Identities = 83/228 (36%), Positives = 126/228 (55%), Gaps = 10/228 (4%) Query: 43 LNDVSLKIGAGKIFVIMGLSGSGKSTLVRHINRLIEPTSGEVLFDGDNILDLGAKALRAF 102 L +VSL + G+ VI G SGSGKSTL+R IN L G + D + + L+ Sbjct: 17 LRNVSLDVARGERIVICGPSGSGKSTLIRCINGLETHDEGVIRIGEDEVRP-DRRVLQRI 75 Query: 103 RMRRVSMVFQSFALMPHRTVLQNVVYG-QRVRGVSKDDAREIGMKWIDTVGLSGYDAKFP 161 R R V MVFQ F L PH T+L+N +VRG+++D A + + ++ V ++ K+P Sbjct: 76 RAR-VGMVFQDFNLFPHLTILENCALAPMKVRGLARDAAEALARELLERVRIADQADKYP 134 Query: 162 HQLSGGMKQRVGLARALAADTDVILMDEAFSALDPLIRGDMQDQLLQLQRNLAK---TIV 218 QLSGG +QR +ARALA ++IL DE SALD +M ++L + + LA T++ Sbjct: 135 AQLSGGQQQRTAIARALAMQPEIILFDEPTSALD----AEMVKEVLDIMKALATEGITML 190 Query: 219 FITHDLDEALRIGSEIAILRDGQVVQVGTPNDILDNPANDYVARFVQR 266 +TH++ A + I + GQ+V+ G+P D P ++ F+ R Sbjct: 191 CVTHEMGFAREVADRIIFMDAGQIVETGSPRDFFTAPCHERTRAFLSR 238 Lambda K H 0.323 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 194 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 241 Length adjustment: 24 Effective length of query: 251 Effective length of database: 217 Effective search space: 54467 Effective search space used: 54467 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory