Align Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized)
to candidate WP_012049963.1 SWIT_RS19090 ABC transporter ATP-binding protein
Query= SwissProt::Q9F9B0 (260 letters) >NCBI__GCF_000016765.1:WP_012049963.1 Length = 516 Score = 105 bits (261), Expect = 3e-27 Identities = 72/218 (33%), Positives = 121/218 (55%), Gaps = 13/218 (5%) Query: 15 RYGRVTALDRADFDLYPGEILAVIGDNGAGKSSMIKAISGAVTPDEGEIRLEGKPIQFRS 74 R GR+ A+D D D+ GE +A++G +G+GKS++ +AI+ D GE+R G P+ R Sbjct: 281 RRGRLQAVDAVDIDVAEGEAVAIVGGSGSGKSTLARAIARLGPIDAGEVRWRGAPLPPRK 340 Query: 75 PMEAR-QAGIETVYQN--LALSPALSIADNMFLGREIRKPGIMGKWFRSLDRAAMEKQAR 131 M R +AG++ V+Q+ +L P + D + +P LD AA+ + Sbjct: 341 AMRPRDRAGLQPVFQDPVASLDPLWKVRDIVAEPLRRLRP--------DLDDAAVAARVE 392 Query: 132 AKLSELGLMTIQNINQAVETLSGGQRQGVAVARAAAFGSKVVIMDEPTAALGVKESRRVL 191 A L+E+GL + LSGGQ Q VA+ARA ++++DE T+AL V + +L Sbjct: 393 AVLAEVGLDPAL-AGRRPAALSGGQAQRVAIARALGPDPAMLLLDEATSALDVLVAGTIL 451 Query: 192 ELILDV-RRRGLPIVLISHNMPHVFEVADRIHIHRLGR 228 +L+ ++ ++RGL I++I+H++ + RI + GR Sbjct: 452 DLLAELQKQRGLAILMITHDLAVARRLCHRIVVMDAGR 489 Score = 72.4 bits (176), Expect = 2e-17 Identities = 61/230 (26%), Positives = 110/230 (47%), Gaps = 17/230 (7%) Query: 6 ILTARGLVKRYGRVTALDRADFDLYPGEILAVIGDNGAGKSSMIKAISG-AVTPDEGEIR 64 +L A L R G ++ A F + G LA++G +G+GKS A G + +G R Sbjct: 3 LLAADNLDIRIGGRRIVEGASFAIAAGRSLALVGASGSGKSQTCLAPFGLSPATVQGSFR 62 Query: 65 LEGKPIQFRSPMEARQAGIETVYQN----LALSPALSIADNMFLGREIRKPGIMGKWFRS 120 L+G+ + + AR+A + V + P ++ ++ +G ++R+ W ++ Sbjct: 63 LDGEEL-----VGAREARLRHVRGGDVGFVFQQPLTALTPHLTIGAQLREA-----WTQA 112 Query: 121 LDRAAMEKQARAKLSELGLMTI-QNINQAVETLSGGQRQGVAVARAAAFGSKVVIMDEPT 179 + A L +GL + ++Q LSGGQRQ +A A A K+++ DEPT Sbjct: 113 GAPRPSRAEMAAALERVGLNDPRERLDQYPHRLSGGQRQRALIAMAIAHRPKLLVADEPT 172 Query: 180 AALGVKESRRVLELILDV-RRRGLPIVLISHNMPHVFEVADRIHIHRLGR 228 AL ++ L+ + G+ ++L+SH++ V + AD + + GR Sbjct: 173 TALDAMLRAEIMVLLGRLCDEEGMALLLVSHDLAAVADHADAVAVMHAGR 222 Lambda K H 0.321 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 320 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 260 Length of database: 516 Length adjustment: 29 Effective length of query: 231 Effective length of database: 487 Effective search space: 112497 Effective search space used: 112497 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory