Align MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized)
to candidate WP_012048833.1 SWIT_RS13320 amino acid ABC transporter ATP-binding protein
Query= TCDB::Q8DT25 (377 letters) >NCBI__GCF_000016765.1:WP_012048833.1 Length = 241 Score = 129 bits (323), Expect = 1e-34 Identities = 81/234 (34%), Positives = 128/234 (54%), Gaps = 16/234 (6%) Query: 18 HYSVENFNLDIHDKEFIVFVGPSGCGKSTTLRMIAGLEDITEGNLYI-DDKLMNDASPKD 76 ++++ N +LD+ E IV GPSG GKST +R I GLE EG + I +D++ D Sbjct: 14 YHALRNVSLDVARGERIVICGPSGSGKSTLIRCINGLETHDEGVIRIGEDEVRPDRRVLQ 73 Query: 77 R---DIAMVFQNYALYPHMSVYENMAFG-LKLRKYKKDDINKRVHEAAEILGLTEFLERK 132 R + MVFQ++ L+PH+++ EN A +K+R +D E E + + + ++ Sbjct: 74 RIRARVGMVFQDFNLFPHLTILENCALAPMKVRGLARDAAEALARELLERVRIADQADKY 133 Query: 133 PADLSGGQRQRVAMGRAIVRDAKVFLMDEPLSNLDAKLRVAMRAEIAKIHRRIGATTIYV 192 PA LSGGQ+QR A+ RA+ ++ L DEP S LDA++ V +I K G T + V Sbjct: 134 PAQLSGGQQQRTAIARALAMQPEIILFDEPTSALDAEM-VKEVLDIMKALATEGITMLCV 192 Query: 193 THDQTEAMTLADRIVIMSATPNPDKTGSIGRIEQIGTPQELYNEPANKFVAGFI 246 TH+ A +ADRI+ M A G+I + G+P++ + P ++ F+ Sbjct: 193 THEMGFAREVADRIIFMDA----------GQIVETGSPRDFFTAPCHERTRAFL 236 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 197 Number of extensions: 6 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 241 Length adjustment: 27 Effective length of query: 350 Effective length of database: 214 Effective search space: 74900 Effective search space used: 74900 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory