Align TreV, component of Trehalose porter (characterized)
to candidate WP_041378948.1 SWIT_RS04010 ABC transporter ATP-binding protein
Query= TCDB::Q97ZC0 (324 letters) >NCBI__GCF_000016765.1:WP_041378948.1 Length = 252 Score = 136 bits (343), Expect = 5e-37 Identities = 73/214 (34%), Positives = 121/214 (56%), Gaps = 3/214 (1%) Query: 10 KKYGKNIVINGITEKIETGEFFVILGPSGEGKSTLLKILAGIEKLDKGKIIADGADITDK 69 K Y V++ ++ IE G F ++G SG GK+TLLK + + ++D G I +G D+ + Sbjct: 9 KHYAGRHVLDDVSLTIERGSFVALVGASGAGKTTLLKAINRLVEIDTGTIAIEGRDVAAQ 68 Query: 70 PPE--KRNVAMVFQNYALYPNMSVRDNIAFPLKMRGMKKEEIIERVEKAAKLLGI-SEIL 126 P +R + VFQ L+P+MSV +N+A +++G+ +EE RV + L+ + ++ Sbjct: 69 PVAELRRRIGYVFQGIGLFPHMSVAENVALVPRLQGVPREERAARVAELLDLVALPADFA 128 Query: 127 DKKVTQISGGQQQRVALARAIVRNPSYFLLDEPLSNLDARVRTTARGELKRIQKELKGTF 186 +++ Q+SGGQ QRV ARA+ P+ L+DEP LD R + + + + T Sbjct: 129 ERRPAQLSGGQAQRVGFARALAARPAIMLMDEPFGALDPVTRDELGAAYRALHEAMGLTS 188 Query: 187 IYVTHDQKEALSLADRIAILHKGKFEQVSDPKTL 220 + VTHD EAL LADR+ ++ +G+ P+ L Sbjct: 189 LIVTHDMAEALLLADRVIVIGEGRILADQPPRAL 222 Lambda K H 0.318 0.137 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 252 Length adjustment: 26 Effective length of query: 298 Effective length of database: 226 Effective search space: 67348 Effective search space used: 67348 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory