Align N-succinylglutamate 5-semialdehyde dehydrogenase; EC 1.2.1.71; Succinylglutamic semialdehyde dehydrogenase; SGSD (uncharacterized)
to candidate WP_012066669.1 SMED_RS12210 aldehyde dehydrogenase
Query= curated2:Q87L22 (485 letters) >NCBI__GCF_000017145.1:WP_012066669.1 Length = 478 Score = 203 bits (517), Expect = 9e-57 Identities = 142/416 (34%), Positives = 207/416 (49%), Gaps = 10/416 (2%) Query: 2 THWIAGEWVQGQGEEFVSL-SPYNQEVIWRGNGATAEQVDQAVAAARAAFVEWKKRPFAE 60 TH+I G +V+ + +++ +P ++E I AE VD AV AAR A W + P E Sbjct: 5 THYIDGRFVEDRISGRIAVYNPASEEQIAEIPDGPAEVVDAAVDAARKAQPAWSELPPIE 64 Query: 61 REAIVLAFAEKVKENSEKIAEVIAKETGKPIWETRTEAAAMAGKIAISIRAYHDRTGEA- 119 R V A AEK++ + +AE I++E GK + R E MAG + GE Sbjct: 65 RAGYVKAIAEKIRAKVDILAETISREQGKVVSLARGEVLGMAGLMDYMAEWARRIEGEII 124 Query: 120 TREAAGNQIVLRHRPLGVMAVFGPYNFPGHLPNGHIVPALLAGNTVVFKPSEQTPWTGEL 179 + G I L P+GV+A P+NFP +L + PAL+AGNT+V KPSE+TP L Sbjct: 125 ASDRKGETIYLNRVPIGVVAGILPWNFPFYLIGRKLAPALVAGNTIVIKPSEETPLNAFL 184 Query: 180 AMKLWEEAGLPKGVINLVQG-AKETGIALADAKGIDGILFTGSANTGHILHRQFAGQPGK 238 +L +E GLPKGV N+V G + TG AL+ GID + FTGS TG + + A + Sbjct: 185 FAELADEVGLPKGVFNMVSGRGRTTGAALSGHPGIDLVSFTGSVPTG-VAIMEAAAKNLT 243 Query: 239 MLALEMGGNNPMVISDNYGDLDATVYTIIQSAFISAGQRCTCARRLYVPFGEKGDALITK 298 + LE+GG P ++ + DLD V I S I+ GQ C CA R++V + D + Sbjct: 244 RVNLELGGKAPAIVLKD-ADLDLAVEAITASRVINTGQVCNCAERIFVE-RQVADEFTDR 301 Query: 299 LVEATKNIRMDQPFAEPAPFMGPQISVAAAKFILDAQANLQSLGGESLIEAKAGE---AA 355 V+ + P AEP MGP ++ + + G + K E Sbjct: 302 FVKRMAAVTYGDPIAEPTVDMGPLVNALQLDKVEAMVERAREAGASVALGGKRAERNCGH 361 Query: 356 FVSPGII-DVTNIAELPDEEYFGPLLQVVRYEGLDKAVELANDTRFGLSAGLVSTD 410 P ++ T E+ +E FGP+ + E D+AV ANDT +GL++ L + D Sbjct: 362 HYEPTVLTGCTPDMEIMRKEIFGPVAPIAVVEDADEAVHYANDTEYGLTSSLYTQD 417 Lambda K H 0.316 0.134 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 574 Number of extensions: 34 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 485 Length of database: 478 Length adjustment: 34 Effective length of query: 451 Effective length of database: 444 Effective search space: 200244 Effective search space used: 200244 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory