Align phenylpyruvate decarboxylase (EC 4.1.1.43) (characterized)
to candidate WP_012067041.1 SMED_RS14160 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring) subunit alpha
Query= BRENDA::A0A222AKA3 (368 letters) >NCBI__GCF_000017145.1:WP_012067041.1 Length = 410 Score = 182 bits (462), Expect = 1e-50 Identities = 120/342 (35%), Positives = 173/342 (50%), Gaps = 23/342 (6%) Query: 35 AGVPPDRQLLM-YRAMVVGRAFNRQATAFSRQGRLAVYPSSRGQEACQVGSALAVRPTDW 93 AG+ D +LL R M++ RAF+ + RQG+ + Y G+EA A+R D Sbjct: 69 AGLLSDEELLTGLRHMMLLRAFDARMLMAQRQGKTSFYMQHLGEEAVSCAFRKALRKGDM 128 Query: 94 LFPTYRESVALLTRGIDPVQVLTLFRGDQHCGYDPVTEHTAPQCTP------------LA 141 FPTYR++ L+ V+++ ++ DP P LA Sbjct: 129 NFPTYRQAGLLIADDYPMVEMMNQIFSNE---LDPCHGRQLPVMYTSKAHGFFTISGNLA 185 Query: 142 TQCLHAAGLADAARMAGDPIVALAYIGDGATSEGDFHEALNYAAVRRAPVVFLVQNNQYA 201 TQ + A G A A+ + D +A +IGDG+T+E DFH AL +A+ +APV+ + NNQ+A Sbjct: 186 TQYVQAVGWAMASAIKNDTRIAAGWIGDGSTAESDFHSALVFASTYKAPVILNIVNNQWA 245 Query: 202 ISVPLA-KQTAARTLADKAAGYGMPGVRIDGNDVLQVYRAVHDAAERARAGHGPTLIEAV 260 IS + + T A + G+G+P +R+DGND L VY AAERAR GPTLIE V Sbjct: 246 ISTFQGIARGGSGTFAARGLGFGIPALRVDGNDYLAVYAVARWAAERARLNLGPTLIEYV 305 Query: 261 TYRIDAHTNADDDTRYRPAGEADVWAAQDPVDRLERDLLAAGV-LDRAAADGIAAAADAF 319 TYR+ AH+ +DD + YRP E++ W DPV RL++ L+ GV + A A D Sbjct: 306 TYRVGAHSTSDDPSAYRPKTESEAWPLGDPVLRLKKHLVLRGVWSEERHAQAEAEIMDEV 365 Query: 320 -----AGELSARFSAPPTGDPMQMFRHVYHHLPPHLREQSER 356 E A +F VY +PPH+R Q ++ Sbjct: 366 IQAQKEAERHGTLHAGGRPSVRDIFEGVYAEMPPHIRRQRQK 407 Lambda K H 0.319 0.132 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 336 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 368 Length of database: 410 Length adjustment: 30 Effective length of query: 338 Effective length of database: 380 Effective search space: 128440 Effective search space used: 128440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory