Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_011970225.1 SMED_RS26560 ABC transporter ATP-binding protein
Query= uniprot:A0A165KC86 (260 letters) >NCBI__GCF_000017145.1:WP_011970225.1 Length = 244 Score = 181 bits (459), Expect = 1e-50 Identities = 111/254 (43%), Positives = 144/254 (56%), Gaps = 16/254 (6%) Query: 6 NEVVLKVAGISKRFGGLQALSDVGITIKRGQVYGLIGPNGAGKTTFFNVITGLYTPDAGT 65 +E L V +S F GL+AL V +++ G+V GLIGPNG+GKTT N ITG +GT Sbjct: 2 SETRLAVNAVSVEFTGLRALDHVSLSLATGEVVGLIGPNGSGKTTLINAITGQVKLASGT 61 Query: 66 FELAGKPYEPTAVHEVAKAGIARTFQNIRLFAEMTALENVMVGRHIRTGSGLFGAVFRTK 125 + EVA AG++R+FQ +RLF MT ENV A K Sbjct: 62 ITAGSTTLSGLSPREVALAGVSRSFQIVRLFNTMTVFENV-------------EAAALAK 108 Query: 126 GFKAEEAAIAKRAQELLDYVGIGKFADYKARTLSYGDQRRLEIARALATDPQLIALDEPA 185 G A A+R Q LLD +G+ AD LSYGD+RR+EIARALA +P + LDEPA Sbjct: 109 G--ASRTIAAQRTQNLLDELGLAAKADELGENLSYGDKRRVEIARALAAEPLFLLLDEPA 166 Query: 186 AGMNATE-KVQLRELIDRIRNDNRTILLIEHDVKLVMGLCDRVTVLDYGKQIAEGNPAEV 244 AGMN E + L L + +L+I+HD+ L+M LC R+ VL G+ IAEG+ A V Sbjct: 167 AGMNDAETEALLHTLAELPGKRGLGLLIIDHDMGLIMRLCHRLHVLASGRTIAEGDAAHV 226 Query: 245 QKNEKVIEAYLGTG 258 + + VIEAYLG G Sbjct: 227 RSHPAVIEAYLGKG 240 Lambda K H 0.319 0.137 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 192 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 244 Length adjustment: 24 Effective length of query: 236 Effective length of database: 220 Effective search space: 51920 Effective search space used: 51920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory