Align malonate semialdehyde dehydrogenase (CoA-acylating) (EC 1.2.1.18) (characterized)
to candidate WP_011970864.1 SMED_RS30185 aldehyde dehydrogenase family protein
Query= metacyc::MONOMER-18958 (541 letters) >NCBI__GCF_000017145.1:WP_011970864.1 Length = 446 Score = 205 bits (521), Expect = 3e-57 Identities = 141/430 (32%), Positives = 208/430 (48%), Gaps = 24/430 (5%) Query: 96 TSIIKRQGIAFKFVQLLRENMDRIASVIVLEQGKTFADAQGDVLRGLQVAEAACNVTNDL 155 + I++R I K + D + ++ E+GKT A+ G+ +R Q+ E T L Sbjct: 27 SGILERHAILKKTADEILARKDELGRLLSREEGKTLAEGIGETVRAGQIFEFFAGETLRL 86 Query: 156 KGESL-EVATDMETKMIREPLGVIGSICPFNFPAMVPLWSLPLVLVTGNTAVVKPSERVP 214 GE + V + ++ REP+GV+G I P+NFP +P W + L GNT V KP+E VP Sbjct: 87 AGEVVPSVRPGIGVEITREPVGVVGIITPWNFPIAIPAWKVAPALCYGNTVVFKPAELVP 146 Query: 215 GAAMIICELAAKAGVPAGVLNIVHGKHDTVNK-LIDDPRIKALTFVGGDKAGKYIYERGS 273 G + I ++ +AG+P GVLN+V GK V + ++D P ++A+TF G GK + Sbjct: 147 GCSWAIVDILHRAGLPKGVLNLVMGKGSVVGQAMLDSPDVQAITFTGSTATGKRVAVASV 206 Query: 274 QLGKRVQANLGAKNHLVVLPDANKQSFVNAVNGAAFGAAGQRCMAIS-VLVTVG------ 326 + ++ Q +G KN VVL DA+ V A +AF + GQRC A S ++VT G Sbjct: 207 EHNRKYQLEMGGKNPFVVLDDADLSVAVEAAVNSAFFSTGQRCTASSRIIVTEGIHDRFV 266 Query: 327 KTTKEWVKDVVADAKLLKTGSGFDPKSDLGPVINPESLTRAEEIIEDSVQNGAVLELDGR 386 E +K +V D LK G + +GPV++ L + + I Q GA L G Sbjct: 267 AAMGERIKGLVVD-DALKAG------THIGPVVDQSQLNQDTDYIAIGKQEGAKLAFGG- 318 Query: 387 GYKPTNDPEQKFTKGNFLAPTILTNVKPGMRAYDEEIFAPVLAVVNVDTIDEAIELINSN 446 + + T G +L P + T MR EEIF PV AV+ V DEA+ + N Sbjct: 319 ------ELISRDTPGFYLQPALFTEATNEMRISREEIFGPVAAVIRVKDYDEALAVANDT 372 Query: 447 KYGNGVSLFTNSGGSAQYFTKRIDVGQVGINVPIPVPLPMFSFTGSRGSFLGDLNFYGKA 506 +G + T S A +F + + G V +N+P F G + S G GK Sbjct: 373 PFGLSSGIATTSLKHATHFKRNAEAGMVMVNLPTAGVDFHVPFGGRKASSYGPRK-QGKY 431 Query: 507 GITFLTKPKT 516 F T KT Sbjct: 432 AAEFYTNVKT 441 Lambda K H 0.315 0.133 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 537 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 541 Length of database: 446 Length adjustment: 34 Effective length of query: 507 Effective length of database: 412 Effective search space: 208884 Effective search space used: 208884 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory