Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_012067078.1 SMED_RS14380 ABC transporter ATP-binding protein
Query= uniprot:A0A165KC86 (260 letters) >NCBI__GCF_000017145.1:WP_012067078.1 Length = 261 Score = 166 bits (420), Expect = 5e-46 Identities = 99/259 (38%), Positives = 153/259 (59%), Gaps = 10/259 (3%) Query: 1 MTEKSNEVVLKVAGISKRFGGLQALSDVGITIKRGQVYGLIGPNGAGKTTFFNVITGLYT 60 + ++ VVL G+ + FGG A+ DV + + +V+ LIGPNGAGKTT FN++T Sbjct: 7 LVNEAPRVVLSARGLRRDFGGFTAVKDVDLDVHHARVHALIGPNGAGKTTVFNLLTKFLQ 66 Query: 61 PDAGTFELAGKPYEPTAVHEVAKAGIARTFQNIRLFAEMTALENVMVGRHIRTGSGLFGA 120 P GT L G+ TA +VA+ G+ R+FQ +F +T L+NV V ++ + L Sbjct: 67 PTHGTITLLGEDITKTAPDKVARMGLVRSFQISAVFPHLTVLDNVRVA--LQRPNRL--- 121 Query: 121 VFRTKGFKAEEA--AIAKRAQELLDYVGIGKFADYKARTLSYGDQRRLEIARALATDPQL 178 T+ +K A A+ +A+EL+ VG+ K + A LSYG +R LEIA LA +P++ Sbjct: 122 --ATQFWKPLSALDALNGKAEELIRSVGLEKEVNAVAADLSYGRKRVLEIATTLALEPKV 179 Query: 179 IALDEPAAGMNATEKVQLRELIDRIRNDNRTILLIEHDVKLVMGLCDRVTVLDYGKQIAE 238 + LDEP AGM + + E+I + + R +L++EH++ +V LC VTVL G+ +AE Sbjct: 180 LLLDEPMAGMGHEDVGMVAEIIREVARE-RAVLMVEHNLSVVATLCHHVTVLQRGEILAE 238 Query: 239 GNPAEVQKNEKVIEAYLGT 257 G+ A V ++ +V AY+GT Sbjct: 239 GDYATVSEDPRVRTAYMGT 257 Lambda K H 0.319 0.137 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 176 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 261 Length adjustment: 25 Effective length of query: 235 Effective length of database: 236 Effective search space: 55460 Effective search space used: 55460 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory