Align Solute-binding (Aliphatic amino acid) component of ABC transporter (characterized, see rationale)
to candidate WP_011974740.1 SMED_RS02690 branched-chain amino acid ABC transporter substrate-binding protein
Query= uniprot:Q1MDE9 (367 letters) >NCBI__GCF_000017145.1:WP_011974740.1 Length = 368 Score = 540 bits (1391), Expect = e-158 Identities = 263/359 (73%), Positives = 308/359 (85%) Query: 9 TLVASLAFAPLAHADITIGLIAPLTGPVAAYGDQVKNGAQTAVDEINKKGGILGEKVVLE 68 TL A +AFAPLAHADITIG+I PLTGPVAA+G+QVKNGA+ AV+ IN GG+ GEK+VL+ Sbjct: 10 TLAAGVAFAPLAHADITIGVITPLTGPVAAFGEQVKNGAEAAVEAINSAGGVNGEKLVLK 69 Query: 69 LADDAGEPKQGVSAANKVVGDGIRFVVGPVTSGVAIPVSDVLAENGVLMVTPTATAPDLT 128 + DDAGEPKQ VS AN++ G+G+R+VVGPV SG ++P SDVLAENG+LMVTPTAT PDLT Sbjct: 70 IVDDAGEPKQAVSVANQLAGEGVRYVVGPVLSGTSMPASDVLAENGILMVTPTATTPDLT 129 Query: 129 KRGLTNVLRTCGRDDQQAEVAAKYVLKNFKDKRVAIVNDKGAYGKGLADAFKATLNAGGI 188 RGL NVLRTCGRDDQQA VAA YV+KNFKDKRVA+++DKGAYGKGLAD FKA +NAGGI Sbjct: 130 TRGLWNVLRTCGRDDQQAVVAADYVVKNFKDKRVAVLHDKGAYGKGLADGFKAAINAGGI 189 Query: 189 TEVVNDAITPGDKDFSALTTRIKSEKVDVVYFGGYHPEGGLLARQLHDLAANATIIGGDG 248 TE V + +TPG+KDF A+ TR+K+EKVDVVYFGGYH EGGLLARQ+HD A ++GGDG Sbjct: 190 TEAVYEGLTPGEKDFGAIVTRLKAEKVDVVYFGGYHAEGGLLARQMHDQGVKAQLLGGDG 249 Query: 249 LSNTEFWAIGTDAAGGTIFTNASDATKSPDSKAAADALAAKNIPAEAFTLNAYAAVEVLK 308 LSNTE+WAIG +AA GTI+TNASDAT++P + +AL AKNIPAEAFTLNAYAAV+VLK Sbjct: 250 LSNTEYWAIGGEAATGTIYTNASDATRNPAAAPVIEALKAKNIPAEAFTLNAYAAVQVLK 309 Query: 309 AGIEKAGSAEDAEAVATALKDGKEIPTAIGKVTYGETGDLTSQSFSLYKWEAGKIVAAE 367 AGIEKAGS EDA AVATA+K G+ I T IGK+TYGE+GDLTS SFSLYKWE G+ VA E Sbjct: 310 AGIEKAGSTEDATAVATAIKSGEAIDTVIGKLTYGESGDLTSPSFSLYKWEGGQSVAVE 368 Lambda K H 0.312 0.131 0.362 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 545 Number of extensions: 16 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 368 Length adjustment: 30 Effective length of query: 337 Effective length of database: 338 Effective search space: 113906 Effective search space used: 113906 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory