Align D-lactate transporter, ATP-binding component (characterized)
to candidate WP_011972867.1 MAEO_RS00720 ATP-binding cassette domain-containing protein
Query= reanno::Phaeo:GFF1248 (251 letters) >NCBI__GCF_000017185.1:WP_011972867.1 Length = 281 Score = 90.5 bits (223), Expect = 3e-23 Identities = 66/225 (29%), Positives = 116/225 (51%), Gaps = 12/225 (5%) Query: 1 MGILEVKNVGKRF-GGLQALSDVNLSVRENTVHAIIGPNGAGKSTLLNCLVGKLIPDTGS 59 M I+E K++ ++ G AL N+SV + + A++GPNGAGKSTL G L P +G Sbjct: 1 MAIIEAKDIVYKYPDGTLALDRANISVEKGDMVALLGPNGAGKSTLFLHFNGILKPKSGK 60 Query: 60 VMFDGKSVLGRAPYEINQMGISRVFQTPEIFGDLSVLENMMIPCFAKRDGAFEMNAISAV 119 ++ G AP + + + V +T I S ++ + K+D AF ++ Sbjct: 61 ILLKG------APIKYDAKSLMEVRKTVGIVFQNS--DDQLFAPTVKQDVAF--GPLNLG 110 Query: 120 SGQRDILEKAEHMLEEMNMADKRHMNAASMSRGDKRRLEIGMCLSQEPRLLLLDEPTAGM 179 + ++ ++ + L+E+ M + +S G K+R+ I L+ P +++LDEPTAG+ Sbjct: 111 LKEEEVEKRVKEALKEVGMEGFENKPPHHLSGGQKKRVAIAGILAMHPEIMVLDEPTAGL 170 Query: 180 ARADTNNTIDLLKQIKSERDITIAIIEHDMHVVFSLADRITVLAQ 224 + + LL ++ E ITI I HD+ +V A++I V+ + Sbjct: 171 DPMGASKIMKLLYKLNKE-GITIIISTHDVDLVPIYANKIFVMGK 214 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 166 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 281 Length adjustment: 25 Effective length of query: 226 Effective length of database: 256 Effective search space: 57856 Effective search space used: 57856 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory