Align PEB1C, component of Uptake system for glutamate and aspartate (characterized)
to candidate WP_011973701.1 MAEO_RS04980 ABC transporter ATP-binding protein
Query= TCDB::A3ZI83 (242 letters) >NCBI__GCF_000017185.1:WP_011973701.1 Length = 258 Score = 134 bits (337), Expect = 2e-36 Identities = 81/213 (38%), Positives = 124/213 (58%), Gaps = 11/213 (5%) Query: 1 MIELKNVNKYYGTHH----VLKNINLSVKEGEKLVIIGPSGSGKSTTIRCMNGLEEVSSG 56 ++EL+NV K + T ++++N SV E L I+GPSG GKST +R + GLE+ +SG Sbjct: 4 VLELRNVGKKFITERKEVVAVEDVNFSVNSNEFLSIVGPSGCGKSTLLRMIAGLEKPTSG 63 Query: 57 EVVVNNLVLNHKNKIEICRKYCAMVFQHFNLYPHMTVLQNLTLAPMKLQKKSKKEAEETA 116 +++ NKIE MVFQ + L P TVL N+ L ++++ K+E + A Sbjct: 64 TLILEG------NKIEKPDAERGMVFQQYTLLPWKTVLGNVALG-LEIKGMKKEERNKIA 116 Query: 117 FKYLKVVGLLDKANVYPATLSGGQQQRVAIARSLCTKKPYILFDEPTSALDPETIQEVLD 176 ++K++GL + N YP LSGG QQRVAIAR+L +L DEP ALD +T + + Sbjct: 117 KNFIKLIGLEEFENSYPYELSGGMQQRVAIARTLANDPKIVLMDEPFGALDTQTRVILQN 176 Query: 177 VMKEISHQSNTTMVVVTHEMGFAKEVADRIIFM 209 + +I + T+V +TH + A ++DR+I M Sbjct: 177 ELLKIWEKDKKTVVFITHSVEEAVYLSDRVIIM 209 Lambda K H 0.317 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 153 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 258 Length adjustment: 24 Effective length of query: 218 Effective length of database: 234 Effective search space: 51012 Effective search space used: 51012 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory