Align 4-aminobutyrate aminotransferase PuuE; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; EC 2.6.1.19 (characterized)
to candidate WP_011973356.1 MAEO_RS03185 aspartate aminotransferase family protein
Query= SwissProt::P50457 (421 letters) >NCBI__GCF_000017185.1:WP_011973356.1 Length = 403 Score = 216 bits (551), Expect = 8e-61 Identities = 141/397 (35%), Positives = 207/397 (52%), Gaps = 46/397 (11%) Query: 34 LKDVEGNEYIDFAAGIAVLNTGHRHPDLVAAVEQQLQQFTHTA--YQIVPYESYVTLAEK 91 ++D+ G +Y DF AGI V N GH HP++V +++Q + HT+ Y I+P V L +K Sbjct: 43 VEDINGKKYKDFLAGIGVNNVGHCHPEVVKTLQKQAELLIHTSNLYHIIPQ---VQLGKK 99 Query: 92 INALAPVSGQAKTAFFTTGAEAVENAVKIARAH-----TGRPGVIAFSGGFHGRTYMTMA 146 L ++G K F +GAEA E A+K+AR H G +I FHGRT T+ Sbjct: 100 ---LVELTGMDKAFFSNSGAEANEAAIKLARKHGKNNNIGEGEIITMEHSFHGRTLTTIT 156 Query: 147 LTGKVAPYKIGFGPFPGSVYHVPYPSDLHGISTQDSLDAIERLFKSDIEAKQVAAIIFEP 206 T K A Y+ G+ P P +V + + IE L K I K AI+ EP Sbjct: 157 ATAKPA-YQEGYEPLPKGFKYVKF-------------NDIEAL-KEGISNK-TTAIMLEP 200 Query: 207 VQGEGGFNVAPKELVAAIRRLCDEHGIVMIADEVQSGFARTGKLFAMDHYADKPDLMTMA 266 +QGEGG ++A KE + +R +C++ IV+I DEVQ G RTGK+FA +HY KPD++T+A Sbjct: 201 IQGEGGIHIADKEYLKGVRDICNDKNIVLIFDEVQCGMGRTGKMFAYEHYNIKPDILTLA 260 Query: 267 KSLAGGMPLSGVVGNANIMDAPAPGGLGGTYAGNPLAVAAAHAVLNIIDKESLCERANQL 326 K+L GG P+ + + A PG G T+ GNPLA +A++A + ++ E L E + Sbjct: 261 KALGGGAPIGATIATEEVATAFTPGSHGTTFGGNPLACSASYASVRVL--EGLLENTQNM 318 Query: 327 GQRLKNTLIDAKESVPAIAAVRGLGSMIAVE--FNDPQTGEPSAAIAQKIQQRALAQGLL 384 G+ L K I VRG+G MI +E FN I +K+ ++ Sbjct: 319 GEYFITELNKLKNKYGFIKEVRGIGLMIGIELSFN-------GGDIVKKMLEKG-----Y 366 Query: 385 LLTCGAYGNVIRFLYPLTIPDAQFDAAMKILQDALSD 421 L+ C + V+RFL PL + D + L + S+ Sbjct: 367 LINCTS-DVVLRFLPPLIVEKTDIDGLINALDEVFSE 402 Lambda K H 0.319 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 372 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 421 Length of database: 403 Length adjustment: 31 Effective length of query: 390 Effective length of database: 372 Effective search space: 145080 Effective search space used: 145080 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory