Align 5-aminovalerate transaminase (EC 2.6.1.48) (characterized)
to candidate WP_011973917.1 MAEO_RS06130 glutamate-1-semialdehyde 2,1-aminomutase
Query= BRENDA::Q9I6M4 (426 letters) >NCBI__GCF_000017185.1:WP_011973917.1 Length = 432 Score = 145 bits (365), Expect = 3e-39 Identities = 116/339 (34%), Positives = 169/339 (49%), Gaps = 20/339 (5%) Query: 25 PVVAERAENSTVWDVEGREYIDF--AGGIAVLNTGHLHPKVIAAVQEQLGKLSHTCFQVL 82 P A++ + DV+G +YID+ A G AVL GH + + AV EQL H Sbjct: 39 PFFVNNAKDYYLVDVDGNKYIDYCLAYGPAVL--GHANENIANAVIEQL---KHGTAYGC 93 Query: 83 AYEPYIELAEEIAKRVPGDFPKKTLLVTSGSEAVENAVKIARAATGRAGVIAFTGAYHGR 142 E I LA+EI KR+P + V SG+EA +A+++AR T R +I F GAYHG Sbjct: 94 PTEKEITLAKEIIKRMP--CAEMVRFVNSGTEATMSAIRLARGITKRNKIIKFDGAYHGA 151 Query: 143 TMMTLGLTGKVVPYSAGMGLMPGGIFRALAPCELHGVSEDDSIASIERIFKNDAQPQDIA 202 L +G + G PG L ++ D+I I KN+ +IA Sbjct: 152 HDYVLVKSGSGA-LTHGAPNSPGIPEDTTKHTILAPFNDKDAIVEI---IKNNKD--EIA 205 Query: 203 AIIIEPVQGEGGFYVNSKSFMQRLRALCDQHGILLIADEVQTGAGRTGTFFATEQLGIVP 262 II+EPV G G + +++ LR + +++ I+LI DEV TG R A E G+VP Sbjct: 206 CIIVEPVMGNVGCIPPREDYLKFLREITEENNIILIFDEVITGF-RIAKGGAQEYYGVVP 264 Query: 263 DLTTFAKSVGGGFPISGVAGKAEIMDAIAPGGL---GGTYAGSPIACAAALAVLKVFEEE 319 DL T K +GGGFPI + GK E+M+ +P G GT+ G+PI+ A + LK ++ Sbjct: 265 DLATVGKIMGGGFPIGAIVGKKELMENFSPNGTIYQAGTFNGNPISMTAGIETLKNLDDN 324 Query: 320 KLLERSQAVGERLKAGLREIQAKHKVIGDVRGLGSMVAI 358 S++ ++L + E KH + V + SM I Sbjct: 325 FYSTTSKS-AKKLSDFIGETAEKHNIPHKVYTVASMFQI 362 Lambda K H 0.319 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 398 Number of extensions: 23 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 426 Length of database: 432 Length adjustment: 32 Effective length of query: 394 Effective length of database: 400 Effective search space: 157600 Effective search space used: 157600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory