Align high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized)
to candidate WP_011973239.1 MAEO_RS02590 ABC transporter ATP-binding protein
Query= CharProtDB::CH_003736 (237 letters) >NCBI__GCF_000017185.1:WP_011973239.1 Length = 225 Score = 85.5 bits (210), Expect = 8e-22 Identities = 63/207 (30%), Positives = 108/207 (52%), Gaps = 9/207 (4%) Query: 18 IQALHEVSLHINQGEIVTLIGANGAGKTTLLGTLCGDPRATSGRIVFDD---KDITDWQT 74 I AL+ VSL I++GE V ++G +G+GK+TLL + + G + D+ D+ D Q Sbjct: 18 IYALNNVSLKIDEGEFVAIMGPSGSGKSTLLNIIGCLDKPDEGEVYIDNVKTNDLNDNQL 77 Query: 75 AKIMREAVAIVPEGRRVFSRMTVEENLAMGGFFAERDQF--QERIKWVYELFP--RLHER 130 +I R + V + + ++ EN+ + F R + +E+ K E L E+ Sbjct: 78 TEIRRMKIGFVFQQFNLIPLLSALENVELPLIFKYRSEMSSEEKQKRALECLKMAELDEQ 137 Query: 131 RIQ-RAGTMSGGEQQMLAIGRALMSNPRLLLLDEPSLGLAPIIIQQIFDTIEQLREQGMT 189 R +SGG+QQ +AI RAL +N +LL DEP+ L ++ + +++L + G T Sbjct: 138 FANHRPNQLSGGQQQRVAIARALANNAPVLLCDEPTGALDSKTGGKVMELLKKLNKSGKT 197 Query: 190 IFLVEQNANQALKLADRGYVLENGHVV 216 + +V + N K+ADR + +G +V Sbjct: 198 VVVVTHDINVG-KVADRIIDIRDGKIV 223 Lambda K H 0.321 0.137 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 115 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 237 Length of database: 225 Length adjustment: 23 Effective length of query: 214 Effective length of database: 202 Effective search space: 43228 Effective search space used: 43228 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory