Align BadI (characterized)
to candidate WP_049776088.1 XAUT_RS04520 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase
Query= metacyc::MONOMER-892 (260 letters) >NCBI__GCF_000017645.1:WP_049776088.1 Length = 258 Score = 106 bits (264), Expect = 6e-28 Identities = 85/261 (32%), Positives = 120/261 (45%), Gaps = 20/261 (7%) Query: 6 LIYEIRNGVAWIIINRPDKMNAFRGTTCDELIKALYKAGYDKDVGAIVLAGAGDRAFCTG 65 L+ G + +NRPD++NAF L AL A D A++L GAG R FC G Sbjct: 2 LLVAQHEGWVELTLNRPDRLNAFTEELHRSLAAAL-DAAADDACRAVLLTGAG-RGFCAG 59 Query: 66 ---GDQSTHDGNYDGRGTVGLPMEELHTAIRDVPKPVIARVQGYAIGGGNVLATICDLTI 122 GD++ +G D T+ L IR + KPV+ V G A G G +A CD+ + Sbjct: 60 QDLGDRAKAEGPLDLGATIEAFYNPLIRRIRALRKPVVCAVNGVAAGAGANIAFACDIVL 119 Query: 123 CSEKAIFGQVGPKMGSVDPGYGTAFLARVVGEKKAREIWYMCKRYSGKEAEAMGLANLCV 182 + A F Q K+G V GT FL R++G+ +AR + + + S ++AE+ GL V Sbjct: 120 AARSAKFIQAFAKIGLVPDSGGTFFLPRLIGDARARALMLLAEPVSAEKAESWGLIWKAV 179 Query: 183 PHDELDAEVQKWGEELCERSPTALAIAKRSFNMDTAHQAGIAGMGMYA-LKLYYD----- 236 L E + L + LA+ K++ N AG + A L L D Sbjct: 180 DDAALMDEARALASHLASQPTQGLALTKQALNAS-------AGNALDAQLDLERDLQREA 232 Query: 237 --TDESREGVKALQEKRKPEF 255 T + REGV A EKR F Sbjct: 233 GRTPDYREGVSAFMEKRPARF 253 Lambda K H 0.319 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 161 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 258 Length adjustment: 24 Effective length of query: 236 Effective length of database: 234 Effective search space: 55224 Effective search space used: 55224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory