Align NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate WP_012116024.1 XAUT_RS20500 ABC transporter ATP-binding protein
Query= TCDB::Q8YT15 (247 letters) >NCBI__GCF_000017645.1:WP_012116024.1 Length = 240 Score = 208 bits (530), Expect = 7e-59 Identities = 111/238 (46%), Positives = 160/238 (67%), Gaps = 7/238 (2%) Query: 11 LLEVENVHAGYIKDVDILQGVNFRVESGELVTVIGPNGAGKSTLAKTIFGLLTPHTGKIT 70 +LEV ++ AGY K V +L G++ V+ G+LVT+IG NGAGK+T + + G++ P +G + Sbjct: 1 MLEVTDLVAGYGK-VKVLHGLSLTVQEGQLVTLIGSNGAGKTTTLRAVSGMIVPESGSVR 59 Query: 71 FKGKNIAGLKSNQIVRLGMCYVPQIANVFPSLSVEENLEMGAFIRNDSLQPLKD------ 124 G+++ GL + +I + G+ + P+ VFP+ SV +NL +GAF R +P D Sbjct: 60 LDGEDLTGLPAFKITKKGLAHSPEGRRVFPTQSVLDNLLLGAFPRLTGARPRGDVEADLD 119 Query: 125 KIFAMFPRLSDRRRQRAGTLSGGERQMLAMGKALMLEPSLLVLDEPSAALSPILVTQVFE 184 ++FA+FPRL++RR Q AGTLSGGE+QMLAM +ALML P +L+LDEPS L+P LV +VF Sbjct: 120 RMFALFPRLAERRTQLAGTLSGGEQQMLAMARALMLNPRVLLLDEPSMGLAPRLVAEVFS 179 Query: 185 QVKQINQEGTAIILVEQNARKALEMADRGYVLESGRDAISGPGQELLTDPKVAELYLG 242 + ++ +E ++LVEQ A ALE+AD GYV+E+GR A GP L DP V YLG Sbjct: 180 TIARLKEEKITMLLVEQFAAAALEVADFGYVMENGRLAAHGPAAMLKNDPAVRAAYLG 237 Lambda K H 0.317 0.136 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 162 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 240 Length adjustment: 23 Effective length of query: 224 Effective length of database: 217 Effective search space: 48608 Effective search space used: 48608 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory