Align 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase (EC 5.3.3.18) (characterized)
to candidate WP_049776088.1 XAUT_RS04520 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase
Query= BRENDA::P77467 (262 letters) >NCBI__GCF_000017645.1:WP_049776088.1 Length = 258 Score = 300 bits (767), Expect = 3e-86 Identities = 153/252 (60%), Positives = 187/252 (74%), Gaps = 3/252 (1%) Query: 11 KGVMTLTLNRPERLNSFNDEMHAQLAECLKQVERDDTIRCLLLTGAGRGFCAGQDLNDRN 70 +G + LTLNRP+RLN+F +E+H LA L DD R +LLTGAGRGFCAGQDL DR Sbjct: 8 EGWVELTLNRPDRLNAFTEELHRSLAAAL-DAAADDACRAVLLTGAGRGFCAGQDLGDR- 65 Query: 71 VDPTGPAPDLGMSVERFYNPLVRRLAKLPKPVICAVNGVAAGAGATLALGGDIVIAARSA 130 GP DLG ++E FYNPL+RR+ L KPV+CAVNGVAAGAGA +A DIV+AARSA Sbjct: 66 AKAEGPL-DLGATIEAFYNPLIRRIRALRKPVVCAVNGVAAGAGANIAFACDIVLAARSA 124 Query: 131 KFVMAFSKLGLIPDCGGTWLLPRVAGRARAMGLALLGNQLSAEQAHEWGMIWQVVDDETL 190 KF+ AF+K+GL+PD GGT+ LPR+ G ARA L LL +SAE+A WG+IW+ VDD L Sbjct: 125 KFIQAFAKIGLVPDSGGTFFLPRLIGDARARALMLLAEPVSAEKAESWGLIWKAVDDAAL 184 Query: 191 ADTAQQLARHLATQPTFGLGLIKQAINSAETNTLDTQLDLERDYQRLAGRSADYREGVSA 250 D A+ LA HLA+QPT GL L KQA+N++ N LD QLDLERD QR AGR+ DYREGVSA Sbjct: 185 MDEARALASHLASQPTQGLALTKQALNASAGNALDAQLDLERDLQREAGRTPDYREGVSA 244 Query: 251 FLAKRSPQFTGK 262 F+ KR +F+G+ Sbjct: 245 FMEKRPARFSGR 256 Lambda K H 0.321 0.136 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 186 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 258 Length adjustment: 24 Effective length of query: 238 Effective length of database: 234 Effective search space: 55692 Effective search space used: 55692 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory