Align 3-oxopimeloyl-CoA:CoA acetyltransferase (characterized)
to candidate WP_012112646.1 XAUT_RS03140 thiolase family protein
Query= metacyc::MONOMER-20679 (395 letters) >NCBI__GCF_000017645.1:WP_012112646.1 Length = 378 Score = 274 bits (700), Expect = 4e-78 Identities = 167/394 (42%), Positives = 221/394 (56%), Gaps = 20/394 (5%) Query: 1 MTEAVIVSTARTPIGKAYRGALNATEGATLLGHAIEHAVKRAGIDPKEVEDVVMGAAMQQ 60 M A IV AR+P AY+GAL L I V R+G+DP +EDV++G A + Sbjct: 1 MAHAFIVDYARSPFAPAYKGALAGIRPDDLAAGVISTVVGRSGLDPATLEDVILGCAFAE 60 Query: 61 GATGGNIARKALLRAGLPVTTAGTTIDRQCASGLQAIALAARSVLFDGVEIAVGGGGESI 120 G G NIAR A L AGLP++ G+T++R C S +QA+ +A ++ E + GG ES+ Sbjct: 61 GEQGLNIARCASLIAGLPLSVGGSTVNRWCGSSMQAVQMATGAIAMGAGEAFIAGGIESM 120 Query: 121 SLVQNDKMNTFHAV--DPALEAIKGDVYMAMLDTAETVAKRYGISRERQDEYSLESQRRT 178 + V N D AL A ++ M TAE +A RY ISRE QD Y+ SQ + Sbjct: 121 TKVPMMGFNPMPNPRWDDALRA----AFLNMGLTAENLADRYAISREAQDTYAAASQDKA 176 Query: 179 AAAQQGGKFNDEIAPISTKMGVVDKATGAVSFKDITLSQDEGPRPETTAEGLAGLKAVRG 238 A AQ G+ EIAP++T G VDK D R TT + L LKAV Sbjct: 177 ATAQADGRLAAEIAPVATSAGAVDK--------------DGCVRGGTTVDKLGALKAVFK 222 Query: 239 EGFTITAGNASQLSDGASATVIMSDKTAAAKGLKPLGIFRGMVSYGCEPDEMGIGPVFAV 298 G ++TAGN+S L+DGASAT+I+S+ A L PL G GC P+ MGIGPV A Sbjct: 223 AGGSVTAGNSSPLTDGASATLIVSEDFARRHNLAPLARVAGYAVSGCAPEIMGIGPVEAT 282 Query: 299 PRLLKRHGLSVDDIGLWELNEAFAVQVLYCRDKLGIDPEKLNVNGGAISVGHPYGMSGAR 358 + L R ++ D+ + E+NEAFAVQVL C L IDP +LN +GGAI++GHP G +GAR Sbjct: 283 RKALARADITAADLDVIEMNEAFAVQVLACCADLDIDPARLNRDGGAIALGHPLGATGAR 342 Query: 359 LAGHALIEGRRRKAKYAVVTMCVGGGMGSAGLFE 392 L G A +R +Y + T C+GGG G A + E Sbjct: 343 LVGKAAQLLKRDGGRYGLATQCIGGGQGIALVLE 376 Lambda K H 0.316 0.134 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 483 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 378 Length adjustment: 30 Effective length of query: 365 Effective length of database: 348 Effective search space: 127020 Effective search space used: 127020 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory