Align BadI (characterized)
to candidate WP_009546068.1 CCE_RS03960 1,4-dihydroxy-2-naphthoyl-CoA synthase
Query= metacyc::MONOMER-892 (260 letters) >NCBI__GCF_000017845.1:WP_009546068.1 Length = 277 Score = 241 bits (616), Expect = 9e-69 Identities = 125/263 (47%), Positives = 168/263 (63%), Gaps = 7/263 (2%) Query: 3 FEDLIYEIRNGVAWIIINRPDKMNAFRGTTCDELIKALYKAGYDKDVGAIVLAGAGDR-- 60 +ED++Y +G+A I INRP K NAFR T EL A A D +G I+L GAG Sbjct: 11 YEDILYHKADGIAKITINRPHKRNAFRPKTVFELYDAFCDAREDSSIGVILLTGAGPHTD 70 Query: 61 ---AFCTGGDQSTHD--GNYDGRGTVGLPMEELHTAIRDVPKPVIARVQGYAIGGGNVLA 115 AFC+GGDQS G D G L + +L IR +PK VIA V GYAIGGG+VL Sbjct: 71 GKYAFCSGGDQSVRGQAGYVDDAGIPRLNVLDLQRLIRSMPKVVIALVAGYAIGGGHVLH 130 Query: 116 TICDLTICSEKAIFGQVGPKMGSVDPGYGTAFLARVVGEKKAREIWYMCKRYSGKEAEAM 175 ICDLTI ++ A+FGQ GPK+GS D G+G ++LAR++G+KKAREIW++C++Y+ ++A M Sbjct: 131 VICDLTIAADNAVFGQTGPKVGSFDGGFGASYLARIIGQKKAREIWFLCRQYNAEQALEM 190 Query: 176 GLANLCVPHDELDAEVQKWGEELCERSPTALAIAKRSFNMDTAHQAGIAGMGMYALKLYY 235 GL N VP ++L+ E +W +E+ +SP A+ K +FN D QAG+ + A LYY Sbjct: 191 GLVNCVVPVEQLETEGVQWAKEILSKSPIAIRCLKAAFNADCDGQAGLQELAGNATLLYY 250 Query: 236 DTDESREGVKALQEKRKPEFRKY 258 T+E EG +A EKR P FR+Y Sbjct: 251 MTEEGAEGKQAFLEKRPPNFRQY 273 Lambda K H 0.319 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 264 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 277 Length adjustment: 25 Effective length of query: 235 Effective length of database: 252 Effective search space: 59220 Effective search space used: 59220 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory