Align arginine-pyruvate transaminase (EC 2.6.1.84) (characterized)
to candidate WP_009544618.1 CCE_RS12755 pyridoxal phosphate-dependent aminotransferase
Query= BRENDA::Q9HUI9 (393 letters) >NCBI__GCF_000017845.1:WP_009544618.1 Length = 390 Score = 206 bits (523), Expect = 1e-57 Identities = 122/357 (34%), Positives = 195/357 (54%), Gaps = 6/357 (1%) Query: 30 QGEEILLLSVGDPDFDTPAPIVQAAIDSLLAGNTHYADVRGKRALRQRIAERHRRRSGQA 89 QG ++ S G+PDFDTP I +AA +L G T Y V G+ LRQ IA + + + Sbjct: 29 QGIDVCSFSSGEPDFDTPQHIKEAASSALAQGKTKYGPVAGEPGLRQAIAHKLNQDNQLN 88 Query: 90 VDAEQVVVLAGAQCALYAVVQCLLNPGDEVIVAEPMYVTYEAVFGACGARVVPVPVRSEN 149 A+ ++V G + +L+ ++ L++ GDEVI+ P +++Y + V V +E Sbjct: 89 YSADHIIVTNGGKHSLFNLMLALIDKGDEVIIPAPYWLSYPEMVKLAEGTPVIVNTTAET 148 Query: 150 GFRVQAEEVAALITPRTRAMALNSPHNPSGASLPRATWEALAELCMAHDLWMISDEVYSE 209 +++ E++ IT T+ + LNSP NP+G +ALAE+ + H+LW++SDE+Y + Sbjct: 149 DYKITPEQLRQAITSNTKLLVLNSPSNPTGMVYNHEEIKALAEVVVDHNLWVVSDEIYEK 208 Query: 210 LLFDG-EHVSPASL-PGMADRTATLNSLSKSHAMTGWRVGWVVGPAALCAHLENLALCML 267 +L+DG EH+S SL + RT N +KS++MTGWR+G++ GP L + Sbjct: 209 ILYDGTEHISIGSLGEEIFKRTIISNGFAKSYSMTGWRIGYLAGPGDLIKATSTIQSHST 268 Query: 268 YGSPEFIQDAACTALEAP-LPE-LEAMREAYRRRRDLVIECLADSPGLRPLRPDGGMFVM 325 F Q A ALE+P P+ L+ M +A+ +RR +++E + P L P G +V Sbjct: 269 SNVCTFAQYGAIAALESPDSPQCLQKMLDAFTQRRQVILERIRSIPKLSCPTPMGAFYVF 328 Query: 326 VDIRPTGLSAQAFADRLLDRHGVSVLAGEAFGPSAAGHIRLGLVLGAEPLREACRRI 382 +DI TGL++ F D LL++ V+ + G+AFG A IRL + + RI Sbjct: 329 IDISQTGLNSLEFCDGLLNKQQVAAIPGKAFG--ADNCIRLSYATDLASIEKGMDRI 383 Lambda K H 0.322 0.136 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 365 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 390 Length adjustment: 31 Effective length of query: 362 Effective length of database: 359 Effective search space: 129958 Effective search space used: 129958 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory