Align ornithine carbamoyltransferase, catabolic (EC 2.1.3.3) (characterized)
to candidate WP_009543263.1 CCE_RS22080 aspartate carbamoyltransferase catalytic subunit
Query= metacyc::MONOMER-533 (346 letters) >NCBI__GCF_000017845.1:WP_009543263.1 Length = 329 Score = 66.6 bits (161), Expect = 8e-16 Identities = 60/190 (31%), Positives = 86/190 (45%), Gaps = 15/190 (7%) Query: 15 NFTTAQINYLIDLAIDLNAVNTKLHIQNRPLAGKNIVLLFQKDSTRTRCAFEVAAFDLGM 74 ++T+ + N L+ A V + + L G + LF + STRTR +FE+AA L Sbjct: 13 DWTSEEYNTLLKTASSFREVLSSRTKKVPALQGVVVTNLFFEPSTRTRSSFELAAKRLSA 72 Query: 75 GCTYIGPSGSNFGKKESIEDTAKVLGSMYDGIEFRGFKQSDVDALVKY------SGVPVW 128 P S+ K E+I DTAK +M + KQ+ V + +GV + Sbjct: 73 DILNFSPGSSSLTKGETILDTAKTYLAMGANLMVIRHKQAGVPQAIAQEMDRLETGVGIL 132 Query: 129 N-GLTDAEHPTQMLADYMTI-------KELKGDLKGRKIVFAGDI-KNNVARSLMIGAAF 179 N G EHP+Q L D T+ L+G+KI GDI + VARS + Sbjct: 133 NAGDGQHEHPSQGLLDLFTLCCLLDFDNPRLALLRGKKIAIVGDILHSRVARSNLWSLTA 192 Query: 180 VGMDIVLVGP 189 G D+ LVGP Sbjct: 193 AGADVHLVGP 202 Lambda K H 0.320 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 217 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 346 Length of database: 329 Length adjustment: 28 Effective length of query: 318 Effective length of database: 301 Effective search space: 95718 Effective search space used: 95718 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory