Align 4-guanidinobutyraldehyde dehydrogenase (EC 1.2.1.54) (characterized)
to candidate WP_009544399.1 CCE_RS07540 L-glutamate gamma-semialdehyde dehydrogenase
Query= metacyc::MONOMER-11560 (497 letters) >NCBI__GCF_000017845.1:WP_009544399.1 Length = 990 Score = 221 bits (564), Expect = 7e-62 Identities = 157/496 (31%), Positives = 247/496 (49%), Gaps = 36/496 (7%) Query: 2 TTLTRADWEQRAQQLKIEGRAFINGEYTDAVSGE------TFECLSPV-DGRFLAKVASC 54 T +R ++AQQ ++ + + Y ++GE + L+P + ++ Sbjct: 476 TDYSREVLREKAQQALVKVKDSLGKTYLPLINGEYVQTDVIIDSLNPSKSSEVVGQIGLI 535 Query: 55 DLADANRAVENARATFNSGVWSQLAPAKRKAKLIRFA-DLLRKNVEELALLETLDMGKPI 113 + A +A+ A+ F W + PA +A+++R A DL+ + EL+ +++GK I Sbjct: 536 SIEQAEQALNAAKEAFKD--WKK-TPATERARILRKAGDLMEERRHELSAWICVEVGK-I 591 Query: 114 GDSSSIDIPGAAQAIHWTA---EAIDKVYDEVAPTPHDQLGLVTR---EPVGVVGAIVPW 167 + ++ A + A E +DK Y+ +D G R +P G+ I PW Sbjct: 592 LQQADAEVSEAIDFCRYYADEMERLDKGYN------YDVAGETNRYHYQPRGIALVISPW 645 Query: 168 NFPLLMACWKLGPALATGNSVVLKPSEKSPLTAIRIAQLAIEAGIPAGVLNVLPGYGHTV 227 NFP +A AL TGN +LKP+E S + A +IA++ ++AGIP GV ++PG G V Sbjct: 646 NFPFAIATGMTVAALVTGNCTLLKPAETSTVIAAKIAEILVDAGIPKGVFQLVPGKGSKV 705 Query: 228 GKALALHMDVDTLVFTGSTKI-----AKQLMVYAGESNMKRIWLEAGGKSPNIVFADAPD 282 G + H DV + FTGS ++ A ++ G+ ++KR+ E GGK+ IV A Sbjct: 706 GAYMVNHPDVHLIAFTGSREVGCRIYADAAILQPGQKHLKRVIAEMGGKNAIIVDESADL 765 Query: 283 LQAAAEAAASAIAFNQGEVCTAGSRLLVERSIKDKFLPMVVEALKGWKPGNPLDPQTTVG 342 QA A A SA + G+ C+A SR++V + D FL V+A K G +P T VG Sbjct: 766 DQAVAGAVFSAFGYT-GQKCSAASRIIVLDPVYDAFLERFVDATKSLNVGPTDEPSTQVG 824 Query: 343 ALVDTQQMNTVLSYIEAGHKDGAKLLAGGKRTLEETGGTYVEPTIFDGVTNAMRIAQEEI 402 ++D +L YIE ++ LA G YV PTIF V IAQEEI Sbjct: 825 PVIDATAQKRILEYIETAKQESTLALA----MEAPDNGFYVGPTIFGDVLPNHTIAQEEI 880 Query: 403 FGPVLSVIAFDTAEEAVAIANDTPYGLAAGIWTSDISKAHKTARAVRAGSVWVNQYDGGD 462 FGPV++V+ +EA+ +AN T Y L G+++ + + G++++N+ G Sbjct: 881 FGPVVAVMRVKNFDEALEVANGTDYALTGGLYSRSPEHIEQAQKEFEVGNLYINRTITGA 940 Query: 463 MTA--PFGGFKQSGNG 476 + A PFGGFK SG G Sbjct: 941 IVARQPFGGFKLSGVG 956 Lambda K H 0.316 0.132 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 997 Number of extensions: 43 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 497 Length of database: 990 Length adjustment: 39 Effective length of query: 458 Effective length of database: 951 Effective search space: 435558 Effective search space used: 435558 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 54 (25.4 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory