Align Probable alcohol dehydrogenase AdhA; EC 1.1.1.1 (uncharacterized)
to candidate WP_243397451.1 CCE_RS23020 zinc-dependent alcohol dehydrogenase family protein
Query= curated2:P9WQC0 (346 letters) >NCBI__GCF_000017845.1:WP_243397451.1 Length = 333 Score = 270 bits (689), Expect = 5e-77 Identities = 148/315 (46%), Positives = 194/315 (61%), Gaps = 10/315 (3%) Query: 33 VPRPAPSELLVAVHACGVCRTDLHVTEGDLPVHRERVIPGHEVVGEVIEVGSAVGAAAGG 92 +P+P +LL+ + ACGVCRTDLH+ +G+L + +I GHE+VG V VG V Sbjct: 26 IPQPDDKQLLLKIQACGVCRTDLHIVDGELTQAKFPLILGHEIVGTVEAVGKGVK----- 80 Query: 93 EFDRGDRVGIAWLRHTCGVCKYCRRGSENLCPQSRYTGWDADGGYAEFTTVPAAFAHHLP 152 F G+RVG+ WL TC C+YCR ENLC Q+R+TG+ DGGYAE+T F +P Sbjct: 81 RFSLGERVGVPWLGGTCQHCRYCRTQQENLCEQARFTGYHLDGGYAEYTVANEQFCFAIP 140 Query: 153 SGYSDSELAPLLCAGIIGYRSLLRTELPPGGRLGLYGFGGSAHITAQVALAQGAEIHVMT 212 YSD E+APLLCAG+IGYRS + G ++G YGFG ++HI QVA QG +++ T Sbjct: 141 KRYSDLEVAPLLCAGLIGYRSY--RLVGDGEKIGFYGFGAASHILLQVARHQGRQVYAFT 198 Query: 213 RGA--RARKLALQLGAASAQDAADRPPVPLDAAILFAPVGDLVLPALEALDRGGILAIAG 270 R + A LGA A + PP LD AI+FAPVG LV AL+A+ GG++ AG Sbjct: 199 RPGDDLGQDFARSLGAVWAGGSEQSPPDSLDGAIIFAPVGALVPVALKAVVPGGVVVCAG 258 Query: 271 IHLTDIPDLNYQQHLFQERQIRSVTSNTRADARAFFDFAAQHHIEVTTPEYPLGQADRAL 330 IH++DIP Y Q L+QER +RSV + TR D FF A Q I+ +PL QA+ AL Sbjct: 259 IHMSDIPSFPY-QILWQERVLRSVANLTRQDGEDFFALARQIPIQTQVSSFPLTQANVAL 317 Query: 331 GDLSAGRIAGAAVLL 345 L G+I GAAVL+ Sbjct: 318 DCLRQGKIKGAAVLV 332 Lambda K H 0.321 0.138 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 299 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 346 Length of database: 333 Length adjustment: 28 Effective length of query: 318 Effective length of database: 305 Effective search space: 96990 Effective search space used: 96990 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory