Align High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate WP_009546142.1 CCE_RS04330 ABC transporter ATP-binding protein
Query= TCDB::P21629 (255 letters) >NCBI__GCF_000017845.1:WP_009546142.1 Length = 209 Score = 76.3 bits (186), Expect = 5e-19 Identities = 66/211 (31%), Positives = 105/211 (49%), Gaps = 27/211 (12%) Query: 21 VNGVNLKVEEKQVVSMIGPNGAGKTTVFNCLTGFYQPTGGLIRLDGEEIQGLPGHKIARK 80 + NL++ +++ ++GP+G+GKTT+ L G Q T G I +E+ L ++ Sbjct: 19 LKATNLELGSQELGLVVGPSGSGKTTLLEILAGLAQQTKGRIFWRDQELTFLELQQLC-- 76 Query: 81 GVVRTFQNVRLFKEMTAVENLLVAQHRHLNTNFLAGLFKTPAFRRSEREAMEYAAHWLEE 140 G+V F R F +E L + H + T S R A L E Sbjct: 77 GLVFQFPE-RHFCGSNILEELRLG-HPEITTE-------------SIRNA-------LAE 114 Query: 141 VNLTEFA-NRSAGTLAYGQQRRLEIARCMMTRPRILMLDEPAAGLNPKETDDLKALIAKL 199 V L + N S L+ GQQRRL +A ++ +P +L+LDEP AGL+ L L++KL Sbjct: 115 VGLQDIPLNTSPHRLSGGQQRRLALAVQLIRQPNLLLLDEPTAGLDWSMRLQLAKLLSKL 174 Query: 200 RSEHNVTVLLIEHDMKLVMSISDHIVVINQG 230 + + T+L++ HD +++I+D INQG Sbjct: 175 K--QHWTLLIVSHDPDELLAIADRRWAINQG 203 Lambda K H 0.320 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 128 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 209 Length adjustment: 23 Effective length of query: 232 Effective length of database: 186 Effective search space: 43152 Effective search space used: 43152 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory