Align BadH (characterized)
to candidate WP_009546719.1 CCE_RS01045 glucose 1-dehydrogenase
Query= metacyc::MONOMER-893 (255 letters) >NCBI__GCF_000017845.1:WP_009546719.1 Length = 265 Score = 140 bits (354), Expect = 2e-38 Identities = 91/262 (34%), Positives = 142/262 (54%), Gaps = 13/262 (4%) Query: 1 MARLQNKTAVITGGGGGIGGATCRRFAQEGAKIAVF---DLN-LDAA----EKVAGAIRD 52 M L K ++TG GIG A R EG+ +A+ D+N LD EK+ + + Sbjct: 1 MEELTGKNILVTGATSGIGQAIAARLVAEGSNVALNYRNDINKLDDTKKMIEKMTSKMDN 60 Query: 53 AGGTAEAVRCDIADRTSVDAAIATTTTTLGPVDILVNNAGWDIFKPFTKTEPGEWERLIA 112 GG V D+++ + G +DILVNNAG I+ P + E +++++I Sbjct: 61 KGGQYLPVEGDVSEEKDILRMYDEVIKKWGSLDILVNNAGIQIYDPSEQVETDDFDKVIN 120 Query: 113 INLTGA-LHMHHAVLPGMVERRHGRIVNIASDAARVGSSGEAVYAACKGGLVAFSKTLAR 171 +NL GA L A+ + + G I+N++S + YA KGG+ + ++TLA Sbjct: 121 VNLRGAYLCAREAIQHFLNTEKKGIILNVSSVHEIIPRPQYVSYAISKGGIKSMTQTLAL 180 Query: 172 EHARHGITVNVVCPGPTDTALLADVTSGAANPEKLIEAFTKAIPLGRLGKPDDLAGAIAF 231 E+A +GI VN + PG TDT++ D +P+K +A + IPLGR+G P+++A A AF Sbjct: 181 EYAPYGIRVNAIAPGATDTSINDDWLD---DPQKK-QAMKRRIPLGRVGTPEEMAAAAAF 236 Query: 232 FGSDDAGFITGQVLSVSGGLTM 253 SD+A +ITGQ L + GG+T+ Sbjct: 237 LMSDEAQYITGQTLFIDGGMTL 258 Lambda K H 0.318 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 145 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 265 Length adjustment: 24 Effective length of query: 231 Effective length of database: 241 Effective search space: 55671 Effective search space used: 55671 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory