Align 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35) (characterized)
to candidate WP_198019416.1 CCE_RS05895 SDR family oxidoreductase
Query= BRENDA::Q84X96 (319 letters) >NCBI__GCF_000017845.1:WP_198019416.1 Length = 259 Score = 85.9 bits (211), Expect = 1e-21 Identities = 61/180 (33%), Positives = 100/180 (55%), Gaps = 13/180 (7%) Query: 54 AIITGPTDGIGKAFAFQLAQKGLNLVLVARNPDKLKDVSDSIQAKYSNTQIKTVVMDFSG 113 A+ITG + GIG+AFA +LA + NL+L+AR+ DKL ++ ++ K ++ +K +V D + Sbjct: 4 ALITGASSGIGQAFAEELATRQTNLILIARSQDKLYRLAKHLREK-TSIDVKVMVQDLTE 62 Query: 114 DIDGGVRRIKEAIE--GLEVGILINNAGVSYPYAKY--FHEVDEEMLGNLIKINVEGTTK 169 G +++ + ++ GL V +LINNAG + Y F+E D +I++NV + Sbjct: 63 PQAG--QKVYDWVQNKGLSVDLLINNAG----FGDYGLFYERDLSRQLAMIQLNVTVLVE 116 Query: 170 VTQAVLVNMLKRKRGAIVNMGSGAAALIPSYPFYSVYAGAKTYVDQFSRCLHVEYKKSGI 229 +T L M +R G+I+N+ S A + S+YA K +V F+ L E K GI Sbjct: 117 LTHLFLSQMQQRGEGSIINVSSIAG--FQPLAYMSLYAATKAFVLSFTEALWAENKDKGI 174 Lambda K H 0.322 0.138 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 142 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 319 Length of database: 259 Length adjustment: 26 Effective length of query: 293 Effective length of database: 233 Effective search space: 68269 Effective search space used: 68269 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory