Align succinylornithine transaminase (EC 2.6.1.81) (characterized)
to candidate WP_012709571.1 NGR_RS26550 ornithine--oxo-acid transaminase
Query= BRENDA::O30508 (406 letters) >NCBI__GCF_000018545.1:WP_012709571.1 Length = 401 Score = 264 bits (675), Expect = 3e-75 Identities = 148/385 (38%), Positives = 207/385 (53%), Gaps = 6/385 (1%) Query: 20 NYAPAAFIPVRGEGSRVWDQSGRELIDFAGGIAVTSLGHAHPALVKALTEQAQRIWHVSN 79 NY P + RGEG VWD G +D + + GH HP + KA+ EQAQ++ S Sbjct: 18 NYKPLDVVLTRGEGVFVWDIEGNRYLDCLSAYSAVNQGHCHPKIFKAMVEQAQKLTLTSR 77 Query: 80 VFTNEPALRLARKLVDATFAERVFLANSGAEANEAAFKLARRYANDVYG--PQKYEIIAA 137 F N+ ++ T + +V NSGAEA E A K R++ +V G + EII Sbjct: 78 AFRNDQLALFYEEIAALTGSHKVLPMNSGAEAVETAIKAVRKWGYEVKGVAADQAEIIVC 137 Query: 138 SNSFHGRTLFTVNVGGQPKYSDGFGPKFEGITHVPYNDLEALKAAISDKTCAVVLEPIQG 197 +N+FHGRT+ V P DGFGP G VP+ D++A +AAIS+ T A ++EPIQG Sbjct: 138 ANNFHGRTIGIVGFSTDPDSHDGFGPFAPGFRIVPFGDIDAFRAAISENTVAFLVEPIQG 197 Query: 198 EGGVLPAQQAYLEGARKLCDEHNALLVFDEVQSGMGRVGELFAYMHYGVVPDILSSAKSL 257 E GV+ Y R+LC +H LV DE+Q+G+GR G+L A H + D+ K+L Sbjct: 198 EAGVIVPPAGYFAEVRELCTKHAITLVLDEIQTGLGRTGKLLAEEHEAIEADVTLIGKAL 257 Query: 258 GGGF-PIGAMLTTGEIAKHLSVGTHGTTYGGNPLASAVAEAALDVINTPEVLDGVKAKHE 316 GGF P+ A+L+ E+ L G HG+T+GGNPLA A+A AAL V+ +++ E Sbjct: 258 SGGFYPVSAVLSNSEVLGVLKPGQHGSTFGGNPLACAIARAALKVLTEEGMIENSARMGE 317 Query: 317 RFKSRLQKIGQEYGIFDEIRGMGLLIGAALTDEWKGKARDVLNAAEKEAVMVLQASPDVV 376 RF + L I I E+RG GL++ L E G AR A + ++ D + Sbjct: 318 RFMTGLTDI--RSNIIREVRGRGLMLAVELVPE-AGGARKYCEALKARGILAKDTHGDTI 374 Query: 377 RFAPSLVIDDAEIDEGLERFERAVA 401 R AP LVI E+D LE+F +A Sbjct: 375 RIAPPLVITAGEVDWALEQFAAVLA 399 Lambda K H 0.318 0.135 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 401 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 401 Length adjustment: 31 Effective length of query: 375 Effective length of database: 370 Effective search space: 138750 Effective search space used: 138750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory