Align putrescine-2-oxoglutarate transaminase (EC 2.6.1.82) (characterized)
to candidate WP_012709571.1 NGR_RS26550 ornithine--oxo-acid transaminase
Query= BRENDA::P42588 (459 letters) >NCBI__GCF_000018545.1:WP_012709571.1 Length = 401 Score = 233 bits (595), Expect = 7e-66 Identities = 133/379 (35%), Positives = 207/379 (54%), Gaps = 19/379 (5%) Query: 78 DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQELLDPLRAMLAKTLAALT 137 D +G ++DCL + N GH +P + A+ Q K L S+ + A+ + +AALT Sbjct: 36 DIEGNRYLDCLSAYSAVNQGHCHPKIFKAMVEQAQKLTLTSRAFRNDQLALFYEEIAALT 95 Query: 138 PGKLKYSFFCNSGTESVEAALKLAKAY-QSPRG----KFTFIATSGAFHGKSLGALSATA 192 NSG E+VE A+K + + +G + I + FHG+++G + + Sbjct: 96 GSHKVLPM--NSGAEAVETAIKAVRKWGYEVKGVAADQAEIIVCANNFHGRTIGIVGFST 153 Query: 193 KSTFRKPFMPLLPGFRHVPFGNIEAMRTALNECKKTGDDVAAVILEPIQGEGGVILPPPG 252 F P PGFR VPFG+I+A R A++E + A ++EPIQGE GVI+PP G Sbjct: 154 DPDSHDGFGPFAPGFRIVPFGDIDAFRAAISE------NTVAFLVEPIQGEAGVIVPPAG 207 Query: 253 YLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312 Y VR+LC + ++LDE+QTG+GRTGK+ A EHE ++ D+ + KAL GG P+ A Sbjct: 208 YFAEVRELCTKHAITLVLDEIQTGLGRTGKLLAEEHEAIEADVTLIGKALSGGFYPVSAV 267 Query: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQ 372 ++ EV VL P H +TFGGNPLACA A A + VL E+ + + + G+ + G Sbjct: 268 LSNSEVLGVL--KPGQHGSTFGGNPLACAIARAALKVLTEEGMIENSARMGERFMTGLTD 325 Query: 373 LAREYPDLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432 + ++++E RG+G+++A+E V G E + R ++A + TIRI PPL Sbjct: 326 IR---SNIIREVRGRGLMLAVELVPEAGGARKYCEALKARGILAKD-THGDTIRIAPPLV 381 Query: 433 LTIEQCELVIKAARKALAA 451 +T + + ++ LA+ Sbjct: 382 ITAGEVDWALEQFAAVLAS 400 Lambda K H 0.320 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 423 Number of extensions: 22 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 459 Length of database: 401 Length adjustment: 32 Effective length of query: 427 Effective length of database: 369 Effective search space: 157563 Effective search space used: 157563 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory