Align 2-deoxy-D-ribose dehydrogenase α subunit (characterized)
to candidate WP_012706539.1 NGR_RS02335 (2Fe-2S)-binding protein
Query= metacyc::MONOMER-20832 (151 letters) >NCBI__GCF_000018545.1:WP_012706539.1 Length = 200 Score = 105 bits (262), Expect = 4e-28 Identities = 58/147 (39%), Positives = 80/147 (54%), Gaps = 1/147 (0%) Query: 1 MELRINQKAYQVDADADTPLLWVIRDDLGLTGTKYGCGLAQCGACSVLVDGNVVRSCVTP 60 + L +N + + + D +L V+R+ L LTGTK GC CGAC+VLV+G + SC+T Sbjct: 51 LTLTVNGRGHTLTVDPRQSVLDVLRETLDLTGTKKGCNQGACGACTVLVNGKRIVSCLTL 110 Query: 61 VAGVVGREITTIEAIETDEVGKRVVATWVEHQVAQCGYCQSGQVMAATALLKHTPAPSKA 120 + G I TIE +E D + +VEH QCG+C GQ+M+ + A S Sbjct: 111 ASMYDGARIETIEGVEKDGALHPLQEAFVEHDGLQCGFCTPGQIMSGLGCIAEGHAGSPE 170 Query: 121 QIDAAMI-NLCRCGTYNAIHAAVDDLA 146 +I M N+CRCG Y I AAV D A Sbjct: 171 EIQFWMSGNICRCGAYPGIVAAVADAA 197 Lambda K H 0.320 0.134 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 95 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 151 Length of database: 200 Length adjustment: 19 Effective length of query: 132 Effective length of database: 181 Effective search space: 23892 Effective search space used: 23892 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory