Align GlpP, component of Glycerol uptake porter, GlpSTPQV (characterized)
to candidate WP_012709585.1 NGR_RS26620 sugar ABC transporter permease
Query= TCDB::G3LHZ0 (288 letters) >NCBI__GCF_000018545.1:WP_012709585.1 Length = 288 Score = 534 bits (1376), Expect = e-157 Identities = 256/288 (88%), Positives = 275/288 (95%) Query: 1 MQKTWNNKAWFLVLPVLLLVAFSAVIPLMTVVNYSVQDTFGNNEFFWAGTDWFVQTLHSD 60 M+KTWNNKAWF+VLPVL+LVAFSAVIPLMTVVNYSVQDTFGNNEFFWAGTDWF+ L SD Sbjct: 1 MEKTWNNKAWFMVLPVLVLVAFSAVIPLMTVVNYSVQDTFGNNEFFWAGTDWFMDVLESD 60 Query: 61 RFWESLQRNLLFSFIILALEIPLGIFIALNMPKSGPGVPVCLVLMALPLLIPWNVVGTIW 120 RFW++L RNL+FS IILA+EIPLGI IALNMPK G GVP+CLVLMALPLLIPWNVVGTIW Sbjct: 61 RFWDALTRNLIFSAIILAIEIPLGIVIALNMPKKGIGVPICLVLMALPLLIPWNVVGTIW 120 Query: 121 QVFGRVDIGLLGHTLEAIGLDYNYVRDPIDAWVTVIVMDVWHWTSLVVLLCYAGLVSIPD 180 QVFGRVDIGLLG TL A+G++YNYV++PIDAWVT+IVMDVWHWTSLVVLLCYAGLVSIPD Sbjct: 121 QVFGRVDIGLLGRTLAALGINYNYVQNPIDAWVTLIVMDVWHWTSLVVLLCYAGLVSIPD 180 Query: 181 AYYQAAKIDGASRWSVFRYIQLPKMKRVLLIAVLLRFMDSFMIYTEPFVVTGGGPGNSTT 240 AYYQAAKIDGASRWSVFRYIQLPKMKRVLLIA LLRFMDSFMIYTEPFVVTGGGPGNSTT Sbjct: 181 AYYQAAKIDGASRWSVFRYIQLPKMKRVLLIAFLLRFMDSFMIYTEPFVVTGGGPGNSTT 240 Query: 241 FLSIDLVKMAVGQFDLGPAAAMSIIYFLIILLLSWVFYTVMTSSDENG 288 FLSIDLVKMA+GQFDLGPAAA+SIIYFLIILLLSW+FYTVMT+SD G Sbjct: 241 FLSIDLVKMAIGQFDLGPAAALSIIYFLIILLLSWIFYTVMTTSDAQG 288 Lambda K H 0.329 0.143 0.464 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 415 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 288 Length adjustment: 26 Effective length of query: 262 Effective length of database: 262 Effective search space: 68644 Effective search space used: 68644 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory