Align 3-ketoacyl-CoA thiolase; Acetyl-CoA acyltransferase; Beta-ketothiolase; EC 2.3.1.16 (characterized)
to candidate WP_012706753.1 NGR_RS12215 acetyl-CoA C-acetyltransferase
Query= SwissProt::O32177 (391 letters) >NCBI__GCF_000018545.1:WP_012706753.1 Length = 402 Score = 249 bits (635), Expect = 1e-70 Identities = 149/411 (36%), Positives = 222/411 (54%), Gaps = 33/411 (8%) Query: 1 MKEAVIVSGARTPVGKAKK-GSLATVRPDDLGAICVKETLKRAGGYEGNIDDLIIGCATP 59 M + + RTP G+ KK GSL V L A ++ R G +DD+++GC P Sbjct: 1 MTKVFVYDHVRTPRGRGKKDGSLHEVPSVRLAAKVLEAVRDRNGLDTATVDDIVMGCVDP 60 Query: 60 EAEQGLNMARNIGALAGLPYTVPAITVNRYCSSGLQSIAYAAEKIMLGAYDTAIAGGAES 119 + G + + AG P + ++R+C+SGL ++ + A KI GA D IAGG ES Sbjct: 61 VMDAGSVIPKAAAFEAGYSTRAPGMQISRFCASGLDAVNFGAAKIAQGADDIVIAGGVES 120 Query: 120 MSQVPMMGHVTRPNLALAEKAPEYYMSMGHTAEQVAKKYGVSREDQDAFAVRSHQNAAKA 179 MS+V + + + P Y+M G +A+ +A KYG SR+D DA+AV S + AA A Sbjct: 121 MSRVGLGMSGGSWFMDPSVSLPAYFMPQGVSADLIATKYGFSRDDVDAYAVESQKRAAHA 180 Query: 180 LAEGKFKDEIVPVEVTVTEIGEDHKPMEKQFVFSQDEGVRPQTTADILSTLRPAFSVDGT 239 +G F++ +VPV K + +DE +RP T L++L P+F + G Sbjct: 181 WEKGYFENSVVPV-----------KDQNGLTILDRDEHMRPGTDMQALASLNPSFQMPGE 229 Query: 240 VT---------------------AGNSSQTSDGAAAVMLMDREKADALGLAPLVKFRSFA 278 + AGNSS DGAAAV+L + +A+GL P + R+FA Sbjct: 230 MGGFEAVAIQAHPEIERINYVHHAGNSSGIVDGAAAVLLGSKAGGEAMGLKPRARIRAFA 289 Query: 279 VGGVPPEVMGIGPVEAIPRALKLAGLQLQDIGLFELNEAFASQAIQVIRELGIDEEKVNV 338 G P +M GPV+ + LK A ++L DI LFELNEAFA+ ++ ++ I +++NV Sbjct: 290 NIGSDPALMLTGPVDVTEKLLKRADMKLSDIDLFELNEAFAAVVLRFMQAFDIPHDQINV 349 Query: 339 NGGAIALGHPLGCTGTKLTLSLIHEMKRRNEQFGVVTMCIGGGMGAAGVFE 389 NGGAIA+GHPLG TG + +++ E++RR+ +VT+CIG GMG A + E Sbjct: 350 NGGAIAMGHPLGATGAMILGTVLDELERRDLNTALVTLCIGAGMGTATIIE 400 Lambda K H 0.316 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 420 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 391 Length of database: 402 Length adjustment: 31 Effective length of query: 360 Effective length of database: 371 Effective search space: 133560 Effective search space used: 133560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_012706753.1 NGR_RS12215 (acetyl-CoA C-acetyltransferase)
to HMM TIGR01930 (acetyl-CoA C-acyltransferase (EC 2.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01930.hmm # target sequence database: /tmp/gapView.3102517.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01930 [M=385] Accession: TIGR01930 Description: AcCoA-C-Actrans: acetyl-CoA C-acyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.2e-126 406.6 0.3 6.1e-126 406.4 0.3 1.0 1 NCBI__GCF_000018545.1:WP_012706753.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000018545.1:WP_012706753.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 406.4 0.3 6.1e-126 6.1e-126 1 385 [] 6 400 .. 6 400 .. 0.95 Alignments for each domain: == domain 1 score: 406.4 bits; conditional E-value: 6.1e-126 TIGR01930 1 ivdavRtpig..klggslkelsaedLlaavikelleragldpekidevilGnvlqageq.aniaReaalaagl 70 ++d vRtp g k gsl+e++++ L+a+v++++ +r+gld + +d++++G+v + + + i + aa++ag NCBI__GCF_000018545.1:WP_012706753.1 6 VYDHVRTPRGrgKKDGSLHEVPSVRLAAKVLEAVRDRNGLDTATVDDIVMGCVDPVMDAgSVIPKAAAFEAGY 78 6799*******988********************************************99************* PP TIGR01930 71 pesvpaltvnrvCaSglqAvalaaqkikaGeadvvvaGGvEsmSrvpillkaslrreslklgkakledqllkd 143 +++ p+++++r+CaSgl+Av+ +a+ki+ G+ d+v+aGGvEsmSrv ++++ ++ +++ + l NCBI__GCF_000018545.1:WP_012706753.1 79 STRAPGMQISRFCASGLDAVNFGAAKIAQGADDIVIAGGVESMSRVGLGMSGG--SWFMDPSVS-L------- 141 **********************************************9999987..788888322.2....... PP TIGR01930 144 lvktklsmgetAenlakkygisReeqDeyalrShqkaakAieegkfkdeivpvevkgkkkvvskDegirpntt 216 + +++g++A+ +a+kyg+sR+++D+ya++S+++aa+A+e+g+f++++vpv+ ++ +++++De++rp+t NCBI__GCF_000018545.1:WP_012706753.1 142 -PAYFMPQGVSADLIATKYGFSRDDVDAYAVESQKRAAHAWEKGYFENSVVPVKDQNGLTILDRDEHMRPGTD 213 .34689************************************************998899************* PP TIGR01930 217 lekLakLkpafkekkgs....................tvtAgNssqlnDGAaalllmseevakelgltplari 269 +++La+L+p f+ g+ +++AgNss++ DGAaa+ll s++ +++gl+p ari NCBI__GCF_000018545.1:WP_012706753.1 214 MQALASLNPSFQM-PGEmggfeavaiqahpeierinyVHHAGNSSGIVDGAAAVLLGSKAGGEAMGLKPRARI 285 ***********98.344455666777777888888889*********************************** PP TIGR01930 270 vsaavagvdpeemglgpvpAiekaLkkaglsisdidlvEinEAFAaqvlavekelgsldlekvNvnGGAiAlG 342 +++a++g+dp+ m++gpv +ek+Lk+a++++sdidl+E+nEAFAa+vl ++++++ + ++++NvnGGAiA+G NCBI__GCF_000018545.1:WP_012706753.1 286 RAFANIGSDPALMLTGPVDVTEKLLKRADMKLSDIDLFELNEAFAAVVLRFMQAFD-IPHDQINVNGGAIAMG 357 ********************************************************.88************** PP TIGR01930 343 HPlGasGarivltllkeLkergkkyGlatlCvggGqGaAvile 385 HPlGa+Ga+i+ t+l+eL++r+ + +l+tlC+g G+G+A+i+e NCBI__GCF_000018545.1:WP_012706753.1 358 HPLGATGAMILGTVLDELERRDLNTALVTLCIGAGMGTATIIE 400 *****************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (402 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 15.81 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory