Align 3-keto-5-aminohexanoate cleavage enzyme (EC 2.3.1.247) (characterized)
to candidate WP_202800178.1 NGR_RS14520 3-keto-5-aminohexanoate cleavage protein
Query= BRENDA::Q8RHX2 (272 letters) >NCBI__GCF_000018545.1:WP_202800178.1 Length = 334 Score = 126 bits (316), Expect = 7e-34 Identities = 97/292 (33%), Positives = 143/292 (48%), Gaps = 28/292 (9%) Query: 4 KLIITAAICGAEVTKEHNPAVPYTVEEIAREAESAYKAGASIIHLHVREDDGTPTQDKER 63 KLII A + +++ NP VP+T EEIA EA A +AGASI+H H R +G P E Sbjct: 47 KLIIEARL-NEYMSRSANPNVPFTAEEIALEAAKAREAGASIVHFHARGAEGAPAHGAED 105 Query: 64 FRKCIEAIREKCPDVIIQPSTGGAVGMTDLERLQPTEL-------HPEMATLDCGTCN-- 114 + K I AIR+ C D ++ P+ G RL E+ P++A +D G+ N Sbjct: 106 YAKAITAIRDAC-DCLVYPTLGQITKDGRESRLAHLEVLAKDPATRPDIAPIDTGSTNID 164 Query: 115 --------FGGDEI-FVNTENTIKNFGKILIERGVKPEIEVFDKGMIDYAIRYQKQGFIQ 165 F D + + N T+K F K L E GVKP+ + ++ G + Sbjct: 165 RFDPEARKFLSDTMTYRNDVATLKLFAKRLPELGVKPQFVSWTVAFTRTFEALREMGLVV 224 Query: 166 KPMHFDFVLGVQ-----MSASARDLVFMSESIP-EGSTWTVAGVGRHQFQMAALAIVMGG 219 P + F L Q + + L+ + +P + W+V + AA AI MGG Sbjct: 225 DPAYLMFELTDQGILGGHPGTVKGLLAHLDFLPAQPLEWSVCNKIGNITAPAAAAIEMGG 284 Query: 220 HVRVGFEDNVYIDKGILAKSNGELVERVVRLAKELGREIATPDEARQILSLK 271 HV VG D + + G +NG++V + LA+ +GREIA PDEAR++L L+ Sbjct: 285 HVSVGLGDYGWPELG--TPNNGDVVRHIANLARAMGREIAAPDEAREMLGLR 334 Lambda K H 0.319 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 256 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 334 Length adjustment: 27 Effective length of query: 245 Effective length of database: 307 Effective search space: 75215 Effective search space used: 75215 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory