Align Inositol 2-dehydrogenase (EC 1.1.1.18) (characterized)
to candidate WP_012709115.1 NGR_RS24140 Gfo/Idh/MocA family oxidoreductase
Query= reanno::WCS417:GFF2329 (336 letters) >NCBI__GCF_000018545.1:WP_012709115.1 Length = 340 Score = 313 bits (801), Expect = 5e-90 Identities = 166/337 (49%), Positives = 216/337 (64%), Gaps = 5/337 (1%) Query: 1 MSLKLGVIGTGAIGRDHIRRCSQTLLNSQVVAVTDINLEQAAKVVADLNISAEVYADGHA 60 M+L++GVIGTG IG+DHIRR +Q L +VVAV+DI+ +AA V A+VYA Sbjct: 1 MTLRVGVIGTGMIGQDHIRRLTQVLSAVEVVAVSDIDGARAAAVAPQ---GADVYAAAGD 57 Query: 61 LIHSPEVEAVLVTSWGPSHEEFVLAAIAAGKPVFCEKPLAVTAEGCRKIVDAEVAFGKRL 120 LI S VEAV++ SWGP+HEE +L IAAGKPVFCEKPL TA ++++AEVAFG+RL Sbjct: 58 LIRSETVEAVVICSWGPAHEEQLLDCIAAGKPVFCEKPLVTTAAAALRVMEAEVAFGRRL 117 Query: 121 VQVGFMRPYDDGYRALKAVIDSGQIGEPLMLHCAHRNPTVGEN-YKTDMAITDTLIHELD 179 VQVGFMR +D YR LKA +D+G +G PLM H HRN +V E Y +DM + DTL+H+ Sbjct: 118 VQVGFMRRFDADYRRLKATLDAGVLGAPLMFHSTHRNASVPEGLYTSDMPLNDTLVHDAY 177 Query: 180 VLRWLLNDDYVSVQVVFPRKSSKALAHLRDPQIVLLETAKGTRIDVEVFVNCQYGYDIQC 239 + RWLLND+ V+V PR+S + LRDP +VLL G +DVE+ VN YGYDI+ Sbjct: 178 ISRWLLNDEVTGVEVRVPRRSRRG-GELRDPVVVLLHMGSGALVDVEISVNIAYGYDIRG 236 Query: 240 EVVGETGIAKLPEPSQVQLRSGAKLSNAILMDWKDRFIGAYDVELQAFIDSVRAGQVGGP 299 EV E G A LP +R + + DW++RFI AYD E + +I + G GP Sbjct: 237 EVSCEEGTASLPLRPATVIRDIHGVRQPVPADWRERFIEAYDQEFREWIVAAAQGTATGP 296 Query: 300 SAWDGFAAAVAADACIEAQNSEQIVKVSLPDRPHFYG 336 S WDG+AA + ADA + A S + V + RP YG Sbjct: 297 STWDGYAATLVADAALRAAESGALEPVRMCQRPSLYG 333 Lambda K H 0.320 0.136 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 315 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 336 Length of database: 340 Length adjustment: 28 Effective length of query: 308 Effective length of database: 312 Effective search space: 96096 Effective search space used: 96096 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory