Align proline racemase (EC 5.1.1.4) (characterized)
to candidate WP_164924152.1 NGR_RS11875 proline racemase family protein
Query= BRENDA::A8DEZ8 (335 letters) >NCBI__GCF_000018545.1:WP_164924152.1 Length = 344 Score = 224 bits (572), Expect = 2e-63 Identities = 119/334 (35%), Positives = 187/334 (55%), Gaps = 2/334 (0%) Query: 1 MKFSRSIQAIDSHTAGEATRIVVGGIPNIKGNSMPEKKEYLEENLDYLRTAIMLEPRGHN 60 M++ R+IQ +D H GE ++ +GG+P I GNS+ E+ ++ D LR + LEPR + Sbjct: 1 MRWKRTIQLLDVHCEGEIGKVAIGGVPKIPGNSIAEQLNHINTVDDSLRRFLCLEPRAAS 60 Query: 61 DMFGSVMTQPCCPDADFGIIFMDGGGYLNMCGHGTIGAMTAAIETGVVPAVEPVTHVVME 120 +++ P P+AD G I + M G +I TA +E+G++ EP T V+++ Sbjct: 61 IGSVNLLLPPKRPEADAGFIILQADQAHAMSGSNSICVTTALLESGMIEMKEPETVVMLD 120 Query: 121 APAGIIRGDVTVVDGKAKEVSFLNVPAFLYKEGVEVDLPGVGTVKFDISFGGSFFAIIHA 180 AG+++ T +G+ + V VP+F+ + V VD P G +K D+ FGG F+A++ Sbjct: 121 TAAGLVKATATCREGRCERVKLTMVPSFVQELDVVVDTPEWGRIKVDLCFGGVFYALVDV 180 Query: 181 SQLGLKIEPQNAGKLTELAMKLRDIINEKIEIQHPTLAHIKTVDLVEIYDEPTHPEATYK 240 Q+G I+ NA ++ E M L+DI+N + + HP + IK V V D T + + Sbjct: 181 RQIGTTIDKTNARRIVEAGMALKDIVNRTLPVVHPEIPEIKGVAYVMFRD--TEADGAVR 238 Query: 241 NVVIFGQGQVDRSPCGTGTSAKLATLHAKGELKVGEKFVYESILGTLFKGEIVEETKVAD 300 G+VDRSPCGTG+SA LATLHA+G++K G+ SI+G+ F+ + T VA Sbjct: 239 TCTTMWPGRVDRSPCGTGSSANLATLHARGKVKPGDVLTSRSIIGSEFEVGLEAVTTVAG 298 Query: 301 FNAVVPKITGSAYITGFNHFVIDEEDPLKHGFIL 334 A++P I+G + G + +D DPL GF L Sbjct: 299 RKAIIPTISGRGWTFGLHQVALDPFDPLADGFAL 332 Lambda K H 0.319 0.139 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 280 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 344 Length adjustment: 28 Effective length of query: 307 Effective length of database: 316 Effective search space: 97012 Effective search space used: 97012 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory